Sequence:
download
CBP09114sequence.fasta
>CBG12234, isoform a MSAAEVADHYNNVRQAGIQDRKESRIFFMRNMNNWIKSQLINDAMKLVNENGVKSPVVLDIACGKGGDLRKWDITGAKHV VMADVADVSIQQAEERYKTMHKYPHDIFGAQFIVADCTKENLDDKIEIKEPFDLVSCQFAMHYSFVDEDSARTFLKNAVG KLKLGGVFIGTLPDADRIVWAVRNGTEGKFANDVCKITYEKVDELSEGNVPLFGAKFHFSLDEQVNCPEFLAYFSLVKHL LEEHDMELLFVHNFAEAITNWLVPGRRLLESMKGLETFPNRNLSGKTDEEYLEAKAKIDSLGDNVPKFVGTLSKSEWEAI CMYLVFGFRKKKTTEKNLESEAPEIKKVTPVPLNEDTDKTAEKNEERIEEKEENPSHC
view sequence (378 aa)
>CBG12234, isoform a
MSAAEVADHYNNVRQAGIQDRKESRIFFMRNMNNWIKSQLINDAMKLVNENGVKSPVVLDIACGKGGDLRKWDITGAKHV
VMADVADVSIQQAEERYKTMHKYPHDIFGAQFIVADCTKENLDDKIEIKEPFDLVSCQFAMHYSFVDEDSARTFLKNAVG
KLKLGGVFIGTLPDADRIVWAVRNGTEGKFANDVCKITYEKVDELSEGNVPLFGAKFHFSLDEQVNCPEFLAYFSLVKHL
LEEHDMELLFVHNFAEAITNWLVPGRRLLESMKGLETFPNRNLSGKTDEEYLEAKAKIDSLGDNVPKFVGTLSKSEWEAI
CMYLVFGFRKKKTTEKNLESEAPEIKKVTPVPLNEDTDKTAEKNEERIEEKEENPSHC
Estimated Isoelectric Point:
5.26030731201172
Estimated Molecular Weight:
42.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys35
Gln8
Leu30
Gly21
Met10
Ser18
Tyr8
His10
Glu38
Arg14
Cys7
Phe21
Pro13
Val29
Asn23
Ala27
Ile19
Trp5
Asp26