Sequence:
download
CBP08385sequence.fasta
>Cbr-RHEB-1 MSSTATQPRYSLNRKVAVMGYPHVGKSSIVQRFTQNMFPDRYETTIEDQHTKHHTAFHRDFNLRVTDTAGQQEYTVFPRS CSLDVAGFLLVYAIDDRKSFDICSSIYEKIISVYGDPSIPIIIVGNKCDLGTQRVVQQEEGKELAKQCEAKFVEITARET NRVNEVFELLLREIEISRGNLRGPPQQQTKEQTSSDPNDPKNCVIS
view sequence (206 aa)
>Cbr-RHEB-1
MSSTATQPRYSLNRKVAVMGYPHVGKSSIVQRFTQNMFPDRYETTIEDQHTKHHTAFHRDFNLRVTDTAGQQEYTVFPRS
CSLDVAGFLLVYAIDDRKSFDICSSIYEKIISVYGDPSIPIIIVGNKCDLGTQRVVQQEEGKELAKQCEAKFVEITARET
NRVNEVFELLLREIEISRGNLRGPPQQQTKEQTSSDPNDPKNCVIS
Estimated Isoelectric Point:
6.22161102294922
Estimated Molecular Weight:
23.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys11
Gln14
Leu11
Gly10
Met3
Ser16
Tyr7
His5
Glu15
Arg14
Cys5
Phe9
Pro10
Val16
Asn9
Ala9
Ile15
Asp12