Sequence:
download
CBP05786sequence.fasta
>Cbr-EFF-1, isoform a MRPRKMRSPNILILIVFWVATSSGFPLEEKFEGLFRAEPPHCSKTPIVRAQTSQNAMSSIARGMQMQFSIGLHTAVCFRL FEDTRLASTSMNGIGDDDAGNQTSLLHTIRLEKLEHHHPITQRYIFGIPEVHASCICECDATASTCTAESHQFTACPESD KSDESTACYRTFFPNQTPIGCSEDDSPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTTIRSQ LDGGTQDRHLDSKRRISLAVTAGGRASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDESGHFHVNNG VVKMDDIHKAKVKNCKEQTYRSILAANNYMPGHFNLSRPLEVSKPWIQSARIFDSSSRQAVVTHAEGTNLQISIHLDDEV ESQNLVFFHNASRIREFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHAANRSMIIPLPA IVGPGARTICLRADSMADIDSICHVVEYFESPLEIDLVEGKWHEMIGTCPTCNQINFNGMMKFLNPAHWIKGISSIGDGV MIATDIVVYLGVLCILYLLITKIIIPLVRCWVCPMSICCSGGSGSSKNKSEKRRRGRDEKRRRENSSSASPNASPRRTHA SPRDAHDTLARYHGGSDRSYYSSSQYI
view sequence (667 aa)
>Cbr-EFF-1, isoform a
MRPRKMRSPNILILIVFWVATSSGFPLEEKFEGLFRAEPPHCSKTPIVRAQTSQNAMSSIARGMQMQFSIGLHTAVCFRL
FEDTRLASTSMNGIGDDDAGNQTSLLHTIRLEKLEHHHPITQRYIFGIPEVHASCICECDATASTCTAESHQFTACPESD
KSDESTACYRTFFPNQTPIGCSEDDSPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTTIRSQ
LDGGTQDRHLDSKRRISLAVTAGGRASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDESGHFHVNNG
VVKMDDIHKAKVKNCKEQTYRSILAANNYMPGHFNLSRPLEVSKPWIQSARIFDSSSRQAVVTHAEGTNLQISIHLDDEV
ESQNLVFFHNASRIREFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHAANRSMIIPLPA
IVGPGARTICLRADSMADIDSICHVVEYFESPLEIDLVEGKWHEMIGTCPTCNQINFNGMMKFLNPAHWIKGISSIGDGV
MIATDIVVYLGVLCILYLLITKIIIPLVRCWVCPMSICCSGGSGSSKNKSEKRRRGRDEKRRRENSSSASPNASPRRTHA
SPRDAHDTLARYHGGSDRSYYSSSQYI
Estimated Isoelectric Point:
7.30884552001953
Estimated Molecular Weight:
74.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr43
Lys29
Gln20
Leu42
Gly42
Met20
Ser68
Tyr20
His25
Glu36
Arg44
Cys21
Phe29
Pro29
Val34
Asn30
Ala43
Ile48
Trp7
Asp37