Sequence:
download
CBP04901sequence.fasta
>Cbr-MOG-4 MSVEQFINDQLHSIVGISDKSICQYVHALAKKAKTPRDLVERLRDDCDFQISPAIQSFAEQLINKMPRAAPVRQKGPTSA ELAERELKRLNNAVGILQDDYGSSSKKTNVRKRKESSSEDEAPAPSKKSTKVAKKKEESDDSDIEAMEAKLDADIAERDA LAARMNKREKEKTRNVMEKKRDDNKDKEGMTMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFANEKLTKREREDME YRKKVLEYAKAHGKAGEVMKIKRYHLPDATSKTIPSQYIEDDEEDLRPGGDGAKWEEEQLMASMLHLGAKDARKNEPEFE LLLDEQIDFIQALQMPGTNEDEKEKETEAEKRKMSIAEVRRSLPVYAFREAFIEAVREHQVLIIEGETGSGKTTQLPQYL YEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSV MMIDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATLDAEKFSGFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDAAI VTVMQIHLTQPLPGDILVFLTGQEEIETLQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATN IAETSVTIDGISYVIDPGFSKQNSFDARSGVEHLHVVTISKAASNQRAGRAGRTGPGKCFRLYTAWAFNNELEDQPIPEI QRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYE CSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESNFSQRWCVENYVQHRTMKRARDVR DQLVGLLERVEIELKSSTDTIKIRKAITAGYFYNVSKLDNSGLYKTVKHKHTTYPHPNSCLFEETPRWVVYYELVFTSKE FMREMSEIESSWLLEVAPHYYKGRELEDSTNKKMPKQRGKSAKDLER
view sequence (1007 aa)
>Cbr-MOG-4
MSVEQFINDQLHSIVGISDKSICQYVHALAKKAKTPRDLVERLRDDCDFQISPAIQSFAEQLINKMPRAAPVRQKGPTSA
ELAERELKRLNNAVGILQDDYGSSSKKTNVRKRKESSSEDEAPAPSKKSTKVAKKKEESDDSDIEAMEAKLDADIAERDA
LAARMNKREKEKTRNVMEKKRDDNKDKEGMTMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFANEKLTKREREDME
YRKKVLEYAKAHGKAGEVMKIKRYHLPDATSKTIPSQYIEDDEEDLRPGGDGAKWEEEQLMASMLHLGAKDARKNEPEFE
LLLDEQIDFIQALQMPGTNEDEKEKETEAEKRKMSIAEVRRSLPVYAFREAFIEAVREHQVLIIEGETGSGKTTQLPQYL
YEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSV
MMIDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATLDAEKFSGFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDAAI
VTVMQIHLTQPLPGDILVFLTGQEEIETLQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATN
IAETSVTIDGISYVIDPGFSKQNSFDARSGVEHLHVVTISKAASNQRAGRAGRTGPGKCFRLYTAWAFNNELEDQPIPEI
QRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYE
CSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESNFSQRWCVENYVQHRTMKRARDVR
DQLVGLLERVEIELKSSTDTIKIRKAITAGYFYNVSKLDNSGLYKTVKHKHTTYPHPNSCLFEETPRWVVYYELVFTSKE
FMREMSEIESSWLLEVAPHYYKGRELEDSTNKKMPKQRGKSAKDLER
Estimated Isoelectric Point:
6.10369110107422
Estimated Molecular Weight:
114.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys85
Gln38
Leu87
Gly48
Met30
Ser62
Tyr32
His22
Glu98
Arg66
Cys13
Phe34
Pro44
Val56
Asn30
Ala84
Ile56
Trp7
Asp65