Sequence:
download
CBP04382sequence.fasta
>Cbr-GPA-16 MGCIMSQTDDAASRSKKIDRLLKEDQENANKTVKLLLLGAGESGKSTILKQMRIIHDVGYTKDERRVFRSVVFGNIILSL NAIIAAMEQLKIEYEKEEHRADARKVLAFGATGEEDEIPDELAALMKSVWSDEGIQKAVARSREYQLNDSAEYYLSQLDR ICEADYIPTQDDVLRTRIKTTGIVETQFIFKDRLFVVFDVGGQRSERKKWIHCFEDVTALIFCVAMSEYDMVLMEDRKTN RMRESLKVFDSICNSKWFVETSIILFLNKKDLFEEKIKKSPLTYCFPEYTGHDNFDDGSAFIQKQFEIVNKRQGGQKEIY TQFTCATDTNNIRFVFDAVTDIVIRDNLRTCGLY
view sequence (354 aa)
>Cbr-GPA-16
MGCIMSQTDDAASRSKKIDRLLKEDQENANKTVKLLLLGAGESGKSTILKQMRIIHDVGYTKDERRVFRSVVFGNIILSL
NAIIAAMEQLKIEYEKEEHRADARKVLAFGATGEEDEIPDELAALMKSVWSDEGIQKAVARSREYQLNDSAEYYLSQLDR
ICEADYIPTQDDVLRTRIKTTGIVETQFIFKDRLFVVFDVGGQRSERKKWIHCFEDVTALIFCVAMSEYDMVLMEDRKTN
RMRESLKVFDSICNSKWFVETSIILFLNKKDLFEEKIKKSPLTYCFPEYTGHDNFDDGSAFIQKQFEIVNKRQGGQKEIY
TQFTCATDTNNIRFVFDAVTDIVIRDNLRTCGLY
Estimated Isoelectric Point:
5.43131256103516
Estimated Molecular Weight:
40.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys28
Gln15
Leu27
Gly17
Met9
Ser20
Tyr11
His4
Glu29
Arg23
Cys8
Phe20
Pro4
Val22
Asn13
Ala22
Ile29
Trp3
Asp29