Sequence:
download
CBP03502sequence.fasta
>Cbr-SUP-12 MYGQVQDPLVHAAAALAQSTTAEPIVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFV TMKDKASADRACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFPPRIGLPQMYYPAVTGFNP LIATQGAAAQQQLIDYSALAAVMGQNPQAAAYGLPSQGKFAAAGPTTIEQYAAAYPAGYGLVPQAAYNLGSSQLQLAAAQ QQLEHQRV
view sequence (248 aa)
>Cbr-SUP-12
MYGQVQDPLVHAAAALAQSTTAEPIVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFV
TMKDKASADRACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFPPRIGLPQMYYPAVTGFNP
LIATQGAAAQQQLIDYSALAAVMGQNPQAAAYGLPSQGKFAAAGPTTIEQYAAAYPAGYGLVPQAAYNLGSSQLQLAAAQ
QQLEHQRV
Estimated Isoelectric Point:
6.90029144287109
Estimated Molecular Weight:
26.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys9
Gln26
Leu22
Gly20
Met5
Ser9
Tyr13
His4
Glu7
Arg8
Cys1
Phe8
Pro17
Val14
Asn8
Ala41
Ile10
Asp10