Sequence:
download
CBP03383sequence.fasta
>Cbr-RNP-3 MADINPNHTIYVNNLNEKVKRDELKRSLHMIFAQYGEIIQLMSFRKERMRGQAHIVFKEVSSASNALRALQGFPFYGKPM RIQYAREDSDVIARAKGSYVEKRAKTTARAAKKPYEKPKNGEKRPEGEEKEKETTAENEGPGLPNNILFCSNIPDGTDPD QIQHIFGQFPGLREVRWMPNTKDFAFVEYESEDMSEPARQALDNFRITPSHQIKVKFATK
view sequence (220 aa)
>Cbr-RNP-3
MADINPNHTIYVNNLNEKVKRDELKRSLHMIFAQYGEIIQLMSFRKERMRGQAHIVFKEVSSASNALRALQGFPFYGKPM
RIQYAREDSDVIARAKGSYVEKRAKTTARAAKKPYEKPKNGEKRPEGEEKEKETTAENEGPGLPNNILFCSNIPDGTDPD
QIQHIFGQFPGLREVRWMPNTKDFAFVEYESEDMSEPARQALDNFRITPSHQIKVKFATK
Estimated Isoelectric Point:
9.15818023681641
Estimated Molecular Weight:
25.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys20
Gln10
Leu10
Gly12
Met7
Ser11
Tyr7
His5
Glu21
Arg16
Cys1
Phe12
Pro14
Val9
Asn13
Ala18
Ile14
Trp1
Asp10