Sequence:
download
CBP01995sequence.fasta
>Cbr-GSK-3 MNKQLLSCSLKSGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKNRELQI MRKLNHPNIVKLKYFFYSSGDKKDELYLNLILEYVPETVYRVARHYSKQRQSIPMIYVKLYMYQLLRSLAYIHSIGICHR DIKPQNLLIDPETGILKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVIAELLLGQPIFPGD SGVDQLVEIIKVLGTPTREQIQSMNPNYKEFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFF DELRSPDARLPSGRALPQLEMDGPNEVSATGGDMAGPSA
view sequence (359 aa)
>Cbr-GSK-3
MNKQLLSCSLKSGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKNRELQI
MRKLNHPNIVKLKYFFYSSGDKKDELYLNLILEYVPETVYRVARHYSKQRQSIPMIYVKLYMYQLLRSLAYIHSIGICHR
DIKPQNLLIDPETGILKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVIAELLLGQPIFPGD
SGVDQLVEIIKVLGTPTREQIQSMNPNYKEFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFF
DELRSPDARLPSGRALPQLEMDGPNEVSATGGDMAGPSA
Estimated Isoelectric Point:
8.95449066162109
Estimated Molecular Weight:
40.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys25
Gln19
Leu33
Gly20
Met9
Ser26
Tyr19
His7
Glu18
Arg17
Cys5
Phe13
Pro22
Val26
Asn16
Ala22
Ile27
Trp2
Asp17