Sequence:
download
CBP01170sequence.fasta
>Cbr-UNC-43, isoform a MMNACTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE ESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGVVHRDLKPENLLLASKAKGAAVKLADFGLAI EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTP EAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKAAISAVKMVTRMSGVLRTSDST GSVASNGSTTHDTSQIAGTSSQPTSPAAEGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQ KQDIVRVTQTLLDAISCKDFDTYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACV AYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWLCVHVHRSTQPSTNTTVSEF
view sequence (533 aa)
>Cbr-UNC-43, isoform a
MMNACTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQE
ESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGVVHRDLKPENLLLASKAKGAAVKLADFGLAI
EVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTP
EAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKAAISAVKMVTRMSGVLRTSDST
GSVASNGSTTHDTSQIAGTSSQPTSPAAEGAILTTMIATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTIDDNDSEKAQ
KQDIVRVTQTLLDAISCKDFDTYTRLCDTSMTCFEPEALGNLIEGIEFHRFYFDGNRKNQVHTTMLNPNVHIIGEDAACV
AYVKLTQFLDRNGEAHTRQSQESRVWSKKQGRWLCVHVHRSTQPSTNTTVSEF
Estimated Isoelectric Point:
6.98488616943359
Estimated Molecular Weight:
59.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr38
Lys36
Gln22
Leu42
Gly27
Met8
Ser43
Tyr14
His17
Glu33
Arg29
Cys13
Phe19
Pro20
Val35
Asn23
Ala44
Ile30
Trp7
Asp33