Sequence:
download
BM49256sequence.fasta
>Bma-MEC-2 MSTSKHEFILSSSSSSMNPTNSHFIDERSQSFTSLNIKDDLPLSDDSSDEAEKSVMERVDNLIEQLPKSPSILAKKNRMS TVNGLNYDQSCTNVVKFDTNVKQQAEIEAKCNPNIQSELGFCGWILTILSYILIFFTLPISVCMCVKVVQEYERVVVFRL GRLMPGGAKGPGIFFVVPCIDTYRKVDLRVISFEVPPQEILSKDSVTVAVDAVVYFRISNATVSVTNVEDAARSTKLLAQ TTLRNILGTKTLTEMLSDREAISLQMQITLDEATEPWGVKVERVEVKDVRLPIQLQRAMAAEAEAAREARAKVIVAEGEQ KASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPLPIDLLSSFFHRATPKSRNSGPISPYTSVLHAQVSGMG ARNISRFKQSQYQNRSCKQHCTTKCNTEQKFQQQLITLSSPKNSRRIIENRNVTNSNSESWSKIKPNKTGLERFLLEREF SESNTTRALCGSSWACSTSDNLSTSTSCLIDDQQ
view sequence (514 aa)
>Bma-MEC-2
MSTSKHEFILSSSSSSMNPTNSHFIDERSQSFTSLNIKDDLPLSDDSSDEAEKSVMERVDNLIEQLPKSPSILAKKNRMS
TVNGLNYDQSCTNVVKFDTNVKQQAEIEAKCNPNIQSELGFCGWILTILSYILIFFTLPISVCMCVKVVQEYERVVVFRL
GRLMPGGAKGPGIFFVVPCIDTYRKVDLRVISFEVPPQEILSKDSVTVAVDAVVYFRISNATVSVTNVEDAARSTKLLAQ
TTLRNILGTKTLTEMLSDREAISLQMQITLDEATEPWGVKVERVEVKDVRLPIQLQRAMAAEAEAAREARAKVIVAEGEQ
KASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPLPIDLLSSFFHRATPKSRNSGPISPYTSVLHAQVSGMG
ARNISRFKQSQYQNRSCKQHCTTKCNTEQKFQQQLITLSSPKNSRRIIENRNVTNSNSESWSKIKPNKTGLERFLLEREF
SESNTTRALCGSSWACSTSDNLSTSTSCLIDDQQ
Estimated Isoelectric Point:
8.16985321044922
Estimated Molecular Weight:
57.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys30
Gln27
Leu44
Gly16
Met10
Ser63
Tyr8
His5
Glu36
Arg30
Cys12
Phe19
Pro21
Val37
Asn28
Ala34
Ile34
Trp4
Asp21