Sequence:
download
BM47600sequence.fasta
>Bma-SUP-12, isoform b MIPSIYGQLSNTGTIADPLVQAAAAALAAQSAAATASATDTLTTTGIRDTTFTKIFVGGLPYHTSDKTLHEYFEQFGEIE EAVVITDRQTQKSRGYGFVTMKDRVAAERACKDPNPIIDGRKANVNLAYLGAKPRGNIQLAALSNGLQQIPLQTQLQALF PGRIAGLPQLLYPTAAAAAAAAAASNPLMNTLNGLQNTTSLAGAGQVNTSQTQQQYIDYATLAAVAAAGGATTATAQNPF SLHPAVSAAGTVGLEQYAYMPYGLIPANNYAAQLTAAQSQLAAVTQQQAALEHQRV
view sequence (296 aa)
>Bma-SUP-12, isoform b
MIPSIYGQLSNTGTIADPLVQAAAAALAAQSAAATASATDTLTTTGIRDTTFTKIFVGGLPYHTSDKTLHEYFEQFGEIE
EAVVITDRQTQKSRGYGFVTMKDRVAAERACKDPNPIIDGRKANVNLAYLGAKPRGNIQLAALSNGLQQIPLQTQLQALF
PGRIAGLPQLLYPTAAAAAAAAAASNPLMNTLNGLQNTTSLAGAGQVNTSQTQQQYIDYATLAAVAAAGGATTATAQNPF
SLHPAVSAAGTVGLEQYAYMPYGLIPANNYAAQLTAAQSQLAAVTQQQAALEHQRV
Estimated Isoelectric Point:
6.40959930419922
Estimated Molecular Weight:
30.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys7
Gln28
Leu28
Gly22
Met4
Ser13
Tyr12
His4
Glu8
Arg9
Cys1
Phe7
Pro15
Val13
Asn14
Ala58
Ile14
Asp9