Sequence:
download
BM47122sequence.fasta
>Bma-RME-6, isoform a MDLCNEHSGLDTLTMLCERLRSEKLLVASELDTLQRLNEEVDNAQSELAHLAWICRQEQTILSRLINSHPDVRPENCCFL TSQFDSACFIHGYRRIDGQHYSSVTELLNLLLNSPNLVAEILHIADQTLKSNDSPFFELVSCVYSLLYGCSVFPEDERRV LETLFHLLDIQLASHSDPRLLLRRGNVSFCQLYRLFSEGMYSAKIFLTAALHDPVMFVLSQDDVFLDIEPTKTLIRFPAE ERRRRFGEDENSLTFLQNLTAHRRYIESKLVSVANRFIRAITDAMSCFPQSLGCIVRRLYTVLVDHRKLSREQATLICTD LIFTYFICPAIANPETLGVISDTPVTYIARFNLMQIGQILQTLAIAPFEPPSSHIAHFYSQFDQQSMSCVVQHVLASHGE SIESICAVSTESPPQVVEQFVRRMFVGTIAELDCLISAVRCFATGPVSDESIRRALTGLLQRLPIKLSRDDIPNFGVVGF HERSHSNERNADPFFTDTRTLDLIQSGYHRGLRFKHGKSTESTESGRIQIENIEVLVFPLGESREPLGMCSEEKFMESVR NPQRVRKHKTSDESAEKRTRFVDTESIDRTTDGGSDDEAASLSSSIEGNADGMDDDAEDVSTLPDNFSDVVPSSANVSGR GSPSVSDPASNRGGSRSARSAAPTNGGKLKEDANNAVQENNNSRQHNLPNLPVTVRRENTEGLEDKFGKFCLPSQGESRH KYRDETHSLVSESWSTDVLPSDTEGFGFDVRQDGDNSTSTVAPPMLPAVVEVGEPRTESRPSRLGSQRSTIGSAIASLTV SGNGEDRSDTWSVDAVASDSEADPVQRNDDLLMIDDPDSADVTSATNGSANATVLASGNESNMTESSDATVHATVGGHNE NEVSRGNNFSFHHAAKKPMSTTSTDASIFRELNQVNLVASTSSGHVRERLRRQSSGSSFYSKSDVDSEFSKDLNDDALSS LPGDYTPSFRNSVGELVLTSPAASVMATAGSFCNDDIEAGSNVIPANDLMNSLKNDVTLANTQKAEKCNEYEEHIRVRKT ERSNDDKTDEEAIRANWANSGAMPKTYRTPPVTSRLRSQNDDIERNESPVMRKKMNILHGLHKVGESLKMRKGAVVSSLR QSLSQATTMNEITSLKGTNGRDSSAASFGTGVGRFAESHSLDELNTAADLSKRTANEILDKYKGKAVLLYSAEGNNQFLD ENSQQTAKGENEKTSEDSELYYDPDNLTQCRAFVDVKRKLRLVLSSVASLPGVSSVGSESALRRSKMRMSGKTDARQLTE FLQILLAESINGQDKTLCAQIREVMRCLVAFDDRAVRKLLRALKGEHRKRTAYMLYLQQSRLSLLQLRSNLEKLAIRLQR EKLLIGECLVDMLVRFYLEERDLQLRRFIAEFQTLKAQDERTDIMERALNSLYECLPREKMWRFANAERISFVKKSVERS LMAQLYVYALYPNGEADQSRDSVFHKSVQKLAAEINPDHPQLRISVRLRGECPWPSAQAEIGIINAYKSPRDKMACIVRC CETIENLIILASERGAASADDITPVLVYVLIQANPLALLSNIQYIGAFYANQISGIEAYWWTQFTSAVEFIKTLLSQNL
view sequence (1599 aa)
>Bma-RME-6, isoform a
MDLCNEHSGLDTLTMLCERLRSEKLLVASELDTLQRLNEEVDNAQSELAHLAWICRQEQTILSRLINSHPDVRPENCCFL
TSQFDSACFIHGYRRIDGQHYSSVTELLNLLLNSPNLVAEILHIADQTLKSNDSPFFELVSCVYSLLYGCSVFPEDERRV
LETLFHLLDIQLASHSDPRLLLRRGNVSFCQLYRLFSEGMYSAKIFLTAALHDPVMFVLSQDDVFLDIEPTKTLIRFPAE
ERRRRFGEDENSLTFLQNLTAHRRYIESKLVSVANRFIRAITDAMSCFPQSLGCIVRRLYTVLVDHRKLSREQATLICTD
LIFTYFICPAIANPETLGVISDTPVTYIARFNLMQIGQILQTLAIAPFEPPSSHIAHFYSQFDQQSMSCVVQHVLASHGE
SIESICAVSTESPPQVVEQFVRRMFVGTIAELDCLISAVRCFATGPVSDESIRRALTGLLQRLPIKLSRDDIPNFGVVGF
HERSHSNERNADPFFTDTRTLDLIQSGYHRGLRFKHGKSTESTESGRIQIENIEVLVFPLGESREPLGMCSEEKFMESVR
NPQRVRKHKTSDESAEKRTRFVDTESIDRTTDGGSDDEAASLSSSIEGNADGMDDDAEDVSTLPDNFSDVVPSSANVSGR
GSPSVSDPASNRGGSRSARSAAPTNGGKLKEDANNAVQENNNSRQHNLPNLPVTVRRENTEGLEDKFGKFCLPSQGESRH
KYRDETHSLVSESWSTDVLPSDTEGFGFDVRQDGDNSTSTVAPPMLPAVVEVGEPRTESRPSRLGSQRSTIGSAIASLTV
SGNGEDRSDTWSVDAVASDSEADPVQRNDDLLMIDDPDSADVTSATNGSANATVLASGNESNMTESSDATVHATVGGHNE
NEVSRGNNFSFHHAAKKPMSTTSTDASIFRELNQVNLVASTSSGHVRERLRRQSSGSSFYSKSDVDSEFSKDLNDDALSS
LPGDYTPSFRNSVGELVLTSPAASVMATAGSFCNDDIEAGSNVIPANDLMNSLKNDVTLANTQKAEKCNEYEEHIRVRKT
ERSNDDKTDEEAIRANWANSGAMPKTYRTPPVTSRLRSQNDDIERNESPVMRKKMNILHGLHKVGESLKMRKGAVVSSLR
QSLSQATTMNEITSLKGTNGRDSSAASFGTGVGRFAESHSLDELNTAADLSKRTANEILDKYKGKAVLLYSAEGNNQFLD
ENSQQTAKGENEKTSEDSELYYDPDNLTQCRAFVDVKRKLRLVLSSVASLPGVSSVGSESALRRSKMRMSGKTDARQLTE
FLQILLAESINGQDKTLCAQIREVMRCLVAFDDRAVRKLLRALKGEHRKRTAYMLYLQQSRLSLLQLRSNLEKLAIRLQR
EKLLIGECLVDMLVRFYLEERDLQLRRFIAEFQTLKAQDERTDIMERALNSLYECLPREKMWRFANAERISFVKKSVERS
LMAQLYVYALYPNGEADQSRDSVFHKSVQKLAAEINPDHPQLRISVRLRGECPWPSAQAEIGIINAYKSPRDKMACIVRC
CETIENLIILASERGAASADDITPVLVYVLIQANPLALLSNIQYIGAFYANQISGIEAYWWTQFTSAVEFIKTLLSQNL
Estimated Isoelectric Point:
5.48461151123047
Estimated Molecular Weight:
178.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr90
Lys59
Gln63
Leu161
Gly78
Met31
Ser175
Tyr33
His35
Glu117
Arg120
Cys30
Phe61
Pro61
Val100
Asn82
Ala119
Ile74
Trp8
Asp102