Sequence:
download
BM46931sequence.fasta
>Bma-CCDC-47 MMWSSLTNSLLTIWMIVSVQLLRYSNRAAEMDNEFAEFEDMEMEYMSEQEVTLKPHGEANKGPRDKSATVDDNDEDEFTD EDEFSRPIKKAHRQKTESEILPQLRFADVPAHFRSNWASYQVEALVLSVLVLYMLNYIFGRARNRNIANKWFMDATSLLE EQFTLVGDDGTSENLREGHMHKETDSIYTIWCSGRVGCQGMLITLKLVKRQDLIHVVMNLIRPKEDKVIIRIDVDNNEMD SFVFAIGQRKLVTKASKEKMDLSLFTIERKGVDRLGLPSSIVVYAEMFEAVNAIIDPAVLSMFRKYENAIDYFHFSDQYS GYKPSDGESFTRLPETSRVLFFAFKMSSDIVEIDALLRMVFHCFEKIRRYRLSREGKLKADKKRQSVQEAFLKTTHQARQ EAAQARREEKTRERKQRLLEEEDPEKQRRLEKLEQKRDMKMRQPKMKQLKVK
view sequence (452 aa)
>Bma-CCDC-47
MMWSSLTNSLLTIWMIVSVQLLRYSNRAAEMDNEFAEFEDMEMEYMSEQEVTLKPHGEANKGPRDKSATVDDNDEDEFTD
EDEFSRPIKKAHRQKTESEILPQLRFADVPAHFRSNWASYQVEALVLSVLVLYMLNYIFGRARNRNIANKWFMDATSLLE
EQFTLVGDDGTSENLREGHMHKETDSIYTIWCSGRVGCQGMLITLKLVKRQDLIHVVMNLIRPKEDKVIIRIDVDNNEMD
SFVFAIGQRKLVTKASKEKMDLSLFTIERKGVDRLGLPSSIVVYAEMFEAVNAIIDPAVLSMFRKYENAIDYFHFSDQYS
GYKPSDGESFTRLPETSRVLFFAFKMSSDIVEIDALLRMVFHCFEKIRRYRLSREGKLKADKKRQSVQEAFLKTTHQARQ
EAAQARREEKTRERKQRLLEEEDPEKQRRLEKLEQKRDMKMRQPKMKQLKVK
Estimated Isoelectric Point:
6.79903411865234
Estimated Molecular Weight:
53.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys36
Gln20
Leu40
Gly15
Met21
Ser31
Tyr12
His9
Glu44
Arg37
Cys3
Phe23
Pro12
Val28
Asn16
Ala28
Ile23
Trp5
Asp30