Sequence:
download
BM46689sequence.fasta
>Bma-LEV-10 MLSGVILSVLFIFIHWCNTDSNDNQRNVEIIFQCDHIFDSSIPEGEFQLPMLPPSATVSEQISQTEGAKNLQCIYTFVAS PKQRVKLNFDQFHLAGTAGNCETEYVDIYSELEEPDDDLLSAAFGGRYCGSVSPYVRISLNRVIVLVFHSRAASNQRNRL KFSGRYAFISDAPYLVGQKIPPGKCDFVIDSKLKKRGSILSPTYPGTYPKNFRCTYLLNGKTGQRIRLLFRDFDIYFGGE HCPYDSLTIYDGPSNKYPIIRKICGLQQRMVIYSFGPNAFIEFNTTSPAKTDPRGYSLDYEFSNRYVDVLKLMDNQLGIT HLRGSECDLLVRSNRETTHYIHSPKYPLMYPANTTCTFIIDGLQGEQNLEEVILTFENFAVLTETIDNSNSFHSKHSSIN YDDDDDEPCATSYVGIAFVPATINSVLSSGEESNYDATLCDRLENGSHILGPYISDGPRMVLVFSSNEKISSNGDGQKPL GFKAKIQFKTDFGIPGKPIGGSNQCMFQFTKTRGWFNSPRYPANYPLDTNCTYIIKARPDEQIQVYFEQFALYVDEHSTI ETRCTDYLEISDVFVKDGVEKLQLQARYCANTFPGPTVTAFGSHELRVFFLSDHEGTGNGFKAIYQIRKAFTEEIPTKPV ARHCGQRITRTDDFTSGWLVSPGYPIKYNKDLICDWEITVRPNHQVLLHLIKMEIEGSMTAESVNCQNAVIRVDAERGIN ASPTIQEICGTDETVIQPIISKNNTVRIRFFTSPDKVNGLKGFNFTWTEVKKTTDNNECLHPTMYLCTYTKLCIDARLKC NGDKNCGLHDDTDEAYCNKLENAADVRTVLFMAIFSGCIFLLISGFFCYMLKKKLEKKRNKRRRRAKFGMKHQRKPFRNP RPITKADPHLLPAPAASRLTHHNVTTDIISSTMEQRNEKSPNGEMSRNNSSLRHSLKLNDDCNTFYG
view sequence (947 aa)
>Bma-LEV-10
MLSGVILSVLFIFIHWCNTDSNDNQRNVEIIFQCDHIFDSSIPEGEFQLPMLPPSATVSEQISQTEGAKNLQCIYTFVAS
PKQRVKLNFDQFHLAGTAGNCETEYVDIYSELEEPDDDLLSAAFGGRYCGSVSPYVRISLNRVIVLVFHSRAASNQRNRL
KFSGRYAFISDAPYLVGQKIPPGKCDFVIDSKLKKRGSILSPTYPGTYPKNFRCTYLLNGKTGQRIRLLFRDFDIYFGGE
HCPYDSLTIYDGPSNKYPIIRKICGLQQRMVIYSFGPNAFIEFNTTSPAKTDPRGYSLDYEFSNRYVDVLKLMDNQLGIT
HLRGSECDLLVRSNRETTHYIHSPKYPLMYPANTTCTFIIDGLQGEQNLEEVILTFENFAVLTETIDNSNSFHSKHSSIN
YDDDDDEPCATSYVGIAFVPATINSVLSSGEESNYDATLCDRLENGSHILGPYISDGPRMVLVFSSNEKISSNGDGQKPL
GFKAKIQFKTDFGIPGKPIGGSNQCMFQFTKTRGWFNSPRYPANYPLDTNCTYIIKARPDEQIQVYFEQFALYVDEHSTI
ETRCTDYLEISDVFVKDGVEKLQLQARYCANTFPGPTVTAFGSHELRVFFLSDHEGTGNGFKAIYQIRKAFTEEIPTKPV
ARHCGQRITRTDDFTSGWLVSPGYPIKYNKDLICDWEITVRPNHQVLLHLIKMEIEGSMTAESVNCQNAVIRVDAERGIN
ASPTIQEICGTDETVIQPIISKNNTVRIRFFTSPDKVNGLKGFNFTWTEVKKTTDNNECLHPTMYLCTYTKLCIDARLKC
NGDKNCGLHDDTDEAYCNKLENAADVRTVLFMAIFSGCIFLLISGFFCYMLKKKLEKKRNKRRRRAKFGMKHQRKPFRNP
RPITKADPHLLPAPAASRLTHHNVTTDIISSTMEQRNEKSPNGEMSRNNSSLRHSLKLNDDCNTFYG
Estimated Isoelectric Point:
6.91129302978516
Estimated Molecular Weight:
107.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr65
Lys54
Gln33
Leu71
Gly59
Met15
Ser69
Tyr40
His24
Glu50
Arg52
Cys30
Phe55
Pro51
Val46
Asn59
Ala43
Ile68
Trp5
Asp58