Sequence:
download
BM46670sequence.fasta
>Bma-EGL-30 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGNGYSDEDKRAHIRLVYQNIFMA IQAMIRAMDTLNIPYGDQSSDLQDKANVVRAIDYENVTSFEEPYVSYIEDLWSDSGIQECYDRRREYQLTDSAKYYLSDL RRLAASDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN ENRMEESKALFRTIITYPWFTNSSVILFLNKRDLLEEKILYSHLVDYFPEYDGPSRDPIAAREFILKMFVDLNPDADKII YSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
view sequence (355 aa)
>Bma-EGL-30
MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGNGYSDEDKRAHIRLVYQNIFMA
IQAMIRAMDTLNIPYGDQSSDLQDKANVVRAIDYENVTSFEEPYVSYIEDLWSDSGIQECYDRRREYQLTDSAKYYLSDL
RRLAASDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN
ENRMEESKALFRTIITYPWFTNSSVILFLNKRDLLEEKILYSHLVDYFPEYDGPSRDPIAAREFILKMFVDLNPDADKII
YSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Estimated Isoelectric Point:
5.10564422607422
Estimated Molecular Weight:
41.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys17
Gln16
Leu33
Gly11
Met9
Ser22
Tyr19
His6
Glu30
Arg28
Cys6
Phe16
Pro10
Val19
Asn16
Ala20
Ile30
Trp3
Asp28