Sequence:
download
BM45555sequence.fasta
>Bma-UNC-13 MSLLCVTIRKARLQGSQDEFNSYAVVKLQNVKSTTIAVKGNQPCWEQEFIFETNRIDNGMLLELWNKGVLWDKLLGVHYL TLTSVQYSNETGPGKWLQIDQELETRNGQTVGTSRPTGHSILVDVRFELPYDAQGANAEELQEKLQALNRLIEIGDHWQE ERAPLIRSGISEDSDYTSDVSFPVHHPNSSAHQWYSHLHQNKRHQRQYDKNLLPFEQASYEDEEDAYRQQFYPDDSEQIQ KSTEYYDDMLGYSTEVNASLSRHQYSRETVRQESMLRNVYNIENNDEYDRSERNRNSLNYDNDYHDRHYYDPVEQSDDYF HPSTSGEQYQSDEYHNDNEAREQWDDEQNMDWTEEQEPLSYNSIINDDDDDEDGDDDDDNNVDVDDDDDDDDEIWHDYST VMQNKSSTLTNQYDMPPTESEHESLDHPEMNHYYINDLNNHQLNFTNQQLPNGSINNFDQIRYDHNKQYSINEKQEIENE LNEAQCSFERHNNDEMQSKILKVQFTMDDNQQMNEIERINEAELILSKRNYKNLWHKAYEDTCRILGIKPTLLEDDNAEN SSSAFYKSIVAMPDMNISRTKKTIPLVSELTMATKRAQAGLANAAKTTFGDEELKMHVYKKTLQALIYPISCTTPHNFQL TNFQTPTWCHECEGLLWGLARQGLKCAECGVKVHDKCRDLLSADCLSGGKSSKHGEGNRTQNLMAVIRERMKMQERNKPE IFDTVRVIFNVDLETQEESLKQVKTSILEGSSKWSAKIALTVICAQGLIAKDKTGKSDPYVTAQVGKMKKRTRTIHQELN PIWNEKFFFECHNSTDRIKIRVWDEDNDLKSKLRQKLTRESDDFLGQAIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL HINVEIKGEEKLAPYHIQYTCLHEHLFQHHCTEQDEVRLPEIKDDSWKVYFDDTGQEICDEFAMRYGIESIYQAMTHFAC LCTRYMCSGVPAVLSTLLANINAYYAHTTATSAVSASDRFNASNFGRDRFVKLLDQLHNSLRIDLSMYRKYFPSSSPAKL TDLKSTVDLLTSITFFRMKVLELASPPRASNVVSECAKACMQATYQLMFESCCEDGGPSADSVNFWFDFLDYMMRVIEDD KNIYTPVLNQFPQELSVGNLSAATLWQLYKTDLQMALEEHAQTKKCSTPEYMNLYFKVKGFYFKYVADLPQYKDSIPEFP AWFIPFVMDWLNENDEHSMDILRNAYNRDKSDNFPQTSEHTKFSNSVIDVFTQLNEALKLLKQMDCPNPEVYADMMKRFS KTLNKVLLAYADMVQKDFNKFVSDEKLACILMNNVQQLRVQLEKIYENMGGPNLDPTANTVLNNLQKKLNAVLNKLSGQF VESLVPNIHVQMNKLGVILSKIKGPQLPKSQLVAEVDSVLEPLMELLEDKLQDYASQCEKTVLKYLLKELWRATITSMEK LVVLPPLDNKAILKQIPNAEVFCDMTKLMSTHLKEVKNISSVKEMMDIAREYERSLTPKQCTVLDAALDAVKECFHAGGQ GLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQKQQDLPSQEQPVGEVSIQVDLFTHPGTGEQKVTVKILAANDL RWQTVSTFKPFVEVHLVGPHLADKKRKMATKSKSGNWAPKFNETFHFFLGNEGEPEHCELMFQVKDYCFAREDRIVGVGV LQLANMIEQGSCACWVQLGRRFHIDETGLILLRILSQRQTDEVAREFVRLKSECRYETESTIAASMSNQQLAANRVS
view sequence (1757 aa)
>Bma-UNC-13
MSLLCVTIRKARLQGSQDEFNSYAVVKLQNVKSTTIAVKGNQPCWEQEFIFETNRIDNGMLLELWNKGVLWDKLLGVHYL
TLTSVQYSNETGPGKWLQIDQELETRNGQTVGTSRPTGHSILVDVRFELPYDAQGANAEELQEKLQALNRLIEIGDHWQE
ERAPLIRSGISEDSDYTSDVSFPVHHPNSSAHQWYSHLHQNKRHQRQYDKNLLPFEQASYEDEEDAYRQQFYPDDSEQIQ
KSTEYYDDMLGYSTEVNASLSRHQYSRETVRQESMLRNVYNIENNDEYDRSERNRNSLNYDNDYHDRHYYDPVEQSDDYF
HPSTSGEQYQSDEYHNDNEAREQWDDEQNMDWTEEQEPLSYNSIINDDDDDEDGDDDDDNNVDVDDDDDDDDEIWHDYST
VMQNKSSTLTNQYDMPPTESEHESLDHPEMNHYYINDLNNHQLNFTNQQLPNGSINNFDQIRYDHNKQYSINEKQEIENE
LNEAQCSFERHNNDEMQSKILKVQFTMDDNQQMNEIERINEAELILSKRNYKNLWHKAYEDTCRILGIKPTLLEDDNAEN
SSSAFYKSIVAMPDMNISRTKKTIPLVSELTMATKRAQAGLANAAKTTFGDEELKMHVYKKTLQALIYPISCTTPHNFQL
TNFQTPTWCHECEGLLWGLARQGLKCAECGVKVHDKCRDLLSADCLSGGKSSKHGEGNRTQNLMAVIRERMKMQERNKPE
IFDTVRVIFNVDLETQEESLKQVKTSILEGSSKWSAKIALTVICAQGLIAKDKTGKSDPYVTAQVGKMKKRTRTIHQELN
PIWNEKFFFECHNSTDRIKIRVWDEDNDLKSKLRQKLTRESDDFLGQAIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRL
HINVEIKGEEKLAPYHIQYTCLHEHLFQHHCTEQDEVRLPEIKDDSWKVYFDDTGQEICDEFAMRYGIESIYQAMTHFAC
LCTRYMCSGVPAVLSTLLANINAYYAHTTATSAVSASDRFNASNFGRDRFVKLLDQLHNSLRIDLSMYRKYFPSSSPAKL
TDLKSTVDLLTSITFFRMKVLELASPPRASNVVSECAKACMQATYQLMFESCCEDGGPSADSVNFWFDFLDYMMRVIEDD
KNIYTPVLNQFPQELSVGNLSAATLWQLYKTDLQMALEEHAQTKKCSTPEYMNLYFKVKGFYFKYVADLPQYKDSIPEFP
AWFIPFVMDWLNENDEHSMDILRNAYNRDKSDNFPQTSEHTKFSNSVIDVFTQLNEALKLLKQMDCPNPEVYADMMKRFS
KTLNKVLLAYADMVQKDFNKFVSDEKLACILMNNVQQLRVQLEKIYENMGGPNLDPTANTVLNNLQKKLNAVLNKLSGQF
VESLVPNIHVQMNKLGVILSKIKGPQLPKSQLVAEVDSVLEPLMELLEDKLQDYASQCEKTVLKYLLKELWRATITSMEK
LVVLPPLDNKAILKQIPNAEVFCDMTKLMSTHLKEVKNISSVKEMMDIAREYERSLTPKQCTVLDAALDAVKECFHAGGQ
GLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQKQQDLPSQEQPVGEVSIQVDLFTHPGTGEQKVTVKILAANDL
RWQTVSTFKPFVEVHLVGPHLADKKRKMATKSKSGNWAPKFNETFHFFLGNEGEPEHCELMFQVKDYCFAREDRIVGVGV
LQLANMIEQGSCACWVQLGRRFHIDETGLILLRILSQRQTDEVAREFVRLKSECRYETESTIAASMSNQQLAANRVS
Estimated Isoelectric Point:
5.14281463623047
Estimated Molecular Weight:
202.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr98
Lys118
Gln107
Leu165
Gly64
Met50
Ser125
Tyr67
His50
Glu141
Arg74
Cys35
Phe66
Pro61
Val98
Asn109
Ala95
Ile81
Trp25
Asp128