Sequence:
download
BM44341sequence.fasta
>Bma-DCS-1 MDIMAADEIKITDDTKSCNDLKGFKFKEILGEDATRKITFVLLDVNNCNDQAVLIVEKTPFPMDEQDWNTIVSQCSLETL SMNDIYSNHILFPPEKFSGIKTTLINPCTEKHIAKYRDQKRYVIYETPDDYKTITLPYLEEQQFTMKWIFNMLEHKAEMD RIIFEDADPENGFILAPDLKWDGKNLANLYVLAIIRRKGIKSIRDLTSNDLPLLENISKKSYIAIKEKYGIDKHQIRAYF HYQPTFYHLHVHFIHVSYDAPASSVAMAHLLEDVINNIKLVPDYYQRSTLTFTMKENNSLLKSYRDTYQW
view sequence (310 aa)
>Bma-DCS-1
MDIMAADEIKITDDTKSCNDLKGFKFKEILGEDATRKITFVLLDVNNCNDQAVLIVEKTPFPMDEQDWNTIVSQCSLETL
SMNDIYSNHILFPPEKFSGIKTTLINPCTEKHIAKYRDQKRYVIYETPDDYKTITLPYLEEQQFTMKWIFNMLEHKAEMD
RIIFEDADPENGFILAPDLKWDGKNLANLYVLAIIRRKGIKSIRDLTSNDLPLLENISKKSYIAIKEKYGIDKHQIRAYF
HYQPTFYHLHVHFIHVSYDAPASSVAMAHLLEDVINNIKLVPDYYQRSTLTFTMKENNSLLKSYRDTYQW
Estimated Isoelectric Point:
5.71073150634766
Estimated Molecular Weight:
36.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys27
Gln10
Leu28
Gly7
Met9
Ser16
Tyr17
His10
Glu19
Arg10
Cys4
Phe14
Pro13
Val12
Asn18
Ala16
Ile30
Trp4
Asp26