Sequence:
download
BM43983sequence.fasta
>Bma-LAT-1, isoform a MLKAKLLILFLILLLVQSKSAITPSSSKPPSTVATTTTTTDPDVPIQKIFCEGEEANLECPIGRYIAIRLANYGRFTLGL CNPSHRTDLSTTCQNDRTLAIMKLSCDDKQRCLFVVETNRFGFDSCPGEPKYLEIVYSCIEVKTTISTSMATTFNTPTIN QTLLITDLTKTSIAVEFTTVKLLDEDDKQLFCDMITERDIDWPQTEFGMIARVSCPIGSTGYAEWTCGSNGQWESDGPDL SRCISTWSKALLMDAEEADGSLDRLEFLNEIQQRTRRESLIGGDLIALSRAVKLLIPITIYENDADKFVELVVESVNNMA KESQILAWNDLKHLKRRMIADQLMSVIDQVSMAISPLITPDTPRIIMKPNTDVEVEISAVRIHDYVAFPSTSLYRTTDDT VNIPREALTLRNNAIDEAKIIYAAYSSMSQHLQPEPRRGADGTMVPRQIASKIVSISVINSDNKIETIDHLHKPVIITFS TENRVNLSMPQCVWWNRTHLQWSSYGCVVSSHNATHTVCHCNHLTYFAVLMDIHYQQLSIGHNIALTFLTYAGCTISIVC LLLSLFAFQCFGTSGGDRIFIHKNLCFSLLIAEAIFLGGIWQTKNSLCCSIIAGLLHYFFLAAFSWMLLEGFELYYMLVE VFQSKDSKRSYILLFGYGFPLSVIAVSIWFDRFSYGTERYCWLRSDNYFILAFIGPVIVILLCNTVFLVMTLFIVCSHSS IGYTPCKQDRDALKNVRNWLKGSVALITILGLTWTFGLLWIDEQSIHMAYAFTIMNSLQGLFIFLFHVAFNDRLHKDYRK WVKHVSWIPDCMRDDSSHTSRTMPYLPTSNTSKTGQAVSSSSSTASELLYPSMSEKYPALPTPRMVAAIDPRYNNSVQML LARQHCNPNALCDYATISYDDLCTSSTNHYHQPQQSKYYFNCMTPVTFVPNPTFSPIITPEFGTLHFRPPPNFPPPPPPP PPPPPSPPAQSSLLTNRRSATPMLASSTIRVSDDSAYSDSSASTLQCHGEVVTNRSGMLLRMDLSKNPPVFVQGI
view sequence (1035 aa)
>Bma-LAT-1, isoform a
MLKAKLLILFLILLLVQSKSAITPSSSKPPSTVATTTTTTDPDVPIQKIFCEGEEANLECPIGRYIAIRLANYGRFTLGL
CNPSHRTDLSTTCQNDRTLAIMKLSCDDKQRCLFVVETNRFGFDSCPGEPKYLEIVYSCIEVKTTISTSMATTFNTPTIN
QTLLITDLTKTSIAVEFTTVKLLDEDDKQLFCDMITERDIDWPQTEFGMIARVSCPIGSTGYAEWTCGSNGQWESDGPDL
SRCISTWSKALLMDAEEADGSLDRLEFLNEIQQRTRRESLIGGDLIALSRAVKLLIPITIYENDADKFVELVVESVNNMA
KESQILAWNDLKHLKRRMIADQLMSVIDQVSMAISPLITPDTPRIIMKPNTDVEVEISAVRIHDYVAFPSTSLYRTTDDT
VNIPREALTLRNNAIDEAKIIYAAYSSMSQHLQPEPRRGADGTMVPRQIASKIVSISVINSDNKIETIDHLHKPVIITFS
TENRVNLSMPQCVWWNRTHLQWSSYGCVVSSHNATHTVCHCNHLTYFAVLMDIHYQQLSIGHNIALTFLTYAGCTISIVC
LLLSLFAFQCFGTSGGDRIFIHKNLCFSLLIAEAIFLGGIWQTKNSLCCSIIAGLLHYFFLAAFSWMLLEGFELYYMLVE
VFQSKDSKRSYILLFGYGFPLSVIAVSIWFDRFSYGTERYCWLRSDNYFILAFIGPVIVILLCNTVFLVMTLFIVCSHSS
IGYTPCKQDRDALKNVRNWLKGSVALITILGLTWTFGLLWIDEQSIHMAYAFTIMNSLQGLFIFLFHVAFNDRLHKDYRK
WVKHVSWIPDCMRDDSSHTSRTMPYLPTSNTSKTGQAVSSSSSTASELLYPSMSEKYPALPTPRMVAAIDPRYNNSVQML
LARQHCNPNALCDYATISYDDLCTSSTNHYHQPQQSKYYFNCMTPVTFVPNPTFSPIITPEFGTLHFRPPPNFPPPPPPP
PPPPPSPPAQSSLLTNRRSATPMLASSTIRVSDDSAYSDSSASTLQCHGEVVTNRSGMLLRMDLSKNPPVFVQGI
Estimated Isoelectric Point:
6.18038177490234
Estimated Molecular Weight:
116.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr83
Lys37
Gln35
Leu104
Gly41
Met29
Ser100
Tyr35
His26
Glu40
Arg47
Cys32
Phe48
Pro63
Val57
Asn45
Ala60
Ile81
Trp17
Asp55