Sequence:
download
BM42423sequence.fasta
>Bma-SUP-12, isoform a MCKFSKIHSCEILKGVISSSSCAILFCVVCVSLAVPCYFFIFLVKRYLCNVHSLAFLFFSPIARFSSNRISACKMIPSIY GQLSNTGTIADPLVQAAAAALAAQSAAATASATDTLTTTGIRDTTFTKIFVGGLPYHTSDKTLHEYFEQFGEIEEAVVIT DRQTQKSRGYGFVTMKDRVAAERACKDPNPIIDGRKANVNLAYLGAKPRGNIQLAALSNGLQQIPLQTQLQALFPGRIAG LPQLLYPTAAAAAAAAAASNPLMNTLNGLQNTTSLAGAGQVNTSQTQQQYIDYATLAAVAAAGGATTATAQNPFSLHPAV SAAGTVGLEQYAYMPYGLIPANNYAAQLTAAQSQLAAVTQQQAALEHQRV
view sequence (370 aa)
>Bma-SUP-12, isoform a
MCKFSKIHSCEILKGVISSSSCAILFCVVCVSLAVPCYFFIFLVKRYLCNVHSLAFLFFSPIARFSSNRISACKMIPSIY
GQLSNTGTIADPLVQAAAAALAAQSAAATASATDTLTTTGIRDTTFTKIFVGGLPYHTSDKTLHEYFEQFGEIEEAVVIT
DRQTQKSRGYGFVTMKDRVAAERACKDPNPIIDGRKANVNLAYLGAKPRGNIQLAALSNGLQQIPLQTQLQALFPGRIAG
LPQLLYPTAAAAAAAAAASNPLMNTLNGLQNTTSLAGAGQVNTSQTQQQYIDYATLAAVAAAGGATTATAQNPFSLHPAV
SAAGTVGLEQYAYMPYGLIPANNYAAQLTAAQSQLAAVTQQQAALEHQRV
Estimated Isoelectric Point:
8.79907989501953
Estimated Molecular Weight:
39.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys12
Gln28
Leu35
Gly23
Met5
Ser25
Tyr14
His6
Glu9
Arg12
Cys9
Phe16
Pro17
Val20
Asn16
Ala63
Ile21
Asp9