Sequence:
download
BM42366sequence.fasta
>Bma-ZYG-12 MIEEKRNDLDDLIKWMNSLNNEKEITLVDIFPGRTIAEALYKIDPLFFNDNWLNTISCYDQMTNWRLKANNLRKIYRRLW EYYTDQLGAEMTQEWHIDTSQIAECDDSELLCRLLQLVLGVAMFCANSEKFIRPLLDQSESVRWTAMNVMNEIKKILPER SKEKMKTSETSTPEPVESKEQVVDLKSKVESLEQECTHLNEKLKEACTEKEALSSDNESLRLRVDELSEGSIEIESLRKQ IRSLRSVRESTQDALYKIEAERDHLKNVNLQLLDENTELRAKIQDMAPLEEEFKRLKDELEEHRLIAQNCKTLESQITTY KAKLKGYKAQKIEMKVLEDKVATYMESIIALEDEQRKNVALKTQIESLELENSELGAKLNDEIRRSDKAEFDCKQLNERI DEIEKEKEHLRQERRELSEQLLLHDNSNGAPSLYDETTNANSAAILRERVIRLQAENECLLAGNMADDEKLGLKEELNSL TVQKRNLETELKLAHNKSDDLRKRLKELNAIIESGNFVNSDRLTEEQTARERMIIQIAQLEARLEQATRDLEQQIAEKKA LNEELTLSKQQVKNEKDRLTHYMEKARRMIEDLEEQNRAVEGGALSRHEFDSIRRERDTYKQNIEALKESHERSRTMQEE EQRLFTTHAYYMMMQLQQQNSSFKEHSDEKSFLTRQRQCSNFNIMSLLAAGLCLMLALTFFSRNSPSLYSEVSFTGVPPT
view sequence (720 aa)
>Bma-ZYG-12
MIEEKRNDLDDLIKWMNSLNNEKEITLVDIFPGRTIAEALYKIDPLFFNDNWLNTISCYDQMTNWRLKANNLRKIYRRLW
EYYTDQLGAEMTQEWHIDTSQIAECDDSELLCRLLQLVLGVAMFCANSEKFIRPLLDQSESVRWTAMNVMNEIKKILPER
SKEKMKTSETSTPEPVESKEQVVDLKSKVESLEQECTHLNEKLKEACTEKEALSSDNESLRLRVDELSEGSIEIESLRKQ
IRSLRSVRESTQDALYKIEAERDHLKNVNLQLLDENTELRAKIQDMAPLEEEFKRLKDELEEHRLIAQNCKTLESQITTY
KAKLKGYKAQKIEMKVLEDKVATYMESIIALEDEQRKNVALKTQIESLELENSELGAKLNDEIRRSDKAEFDCKQLNERI
DEIEKEKEHLRQERRELSEQLLLHDNSNGAPSLYDETTNANSAAILRERVIRLQAENECLLAGNMADDEKLGLKEELNSL
TVQKRNLETELKLAHNKSDDLRKRLKELNAIIESGNFVNSDRLTEEQTARERMIIQIAQLEARLEQATRDLEQQIAEKKA
LNEELTLSKQQVKNEKDRLTHYMEKARRMIEDLEEQNRAVEGGALSRHEFDSIRRERDTYKQNIEALKESHERSRTMQEE
EQRLFTTHAYYMMMQLQQQNSSFKEHSDEKSFLTRQRQCSNFNIMSLLAAGLCLMLALTFFSRNSPSLYSEVSFTGVPPT
Estimated Isoelectric Point:
5.14505767822266
Estimated Molecular Weight:
84.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr37
Lys56
Gln40
Leu91
Gly14
Met21
Ser51
Tyr15
His12
Glu99
Arg52
Cys11
Phe16
Pro11
Val22
Asn43
Ala45
Ile39
Trp6
Asp39