Sequence:
download
BM40753sequence.fasta
>Bma-UNC-52 MRELCRLRILTSPLVLVLLLLLNSIATVKAWNKWSFNKYQTVDDYYSPSVQITIYPTEENIYEGNDATFNCRARTSDGVT HSEVRWTRYNAPMPNSAYEVDGRLKFSSAVSSDSGRYICSANIGGRTYDASAQLNVQRYGPQEFQNILPQTGLCRIDERA CGNNECVKTDYVCDGEPDCRDRSDEQNCPSLRSCEPNEFMCTNGRCVQKMWLCDGDDDCGDNSDEQACSHRAASDGCATS EFKCRDGRQCVPLSFHCDGTNDCQDGSDEIGCVQPTIVQPPETNKQVHAGGTFQLTCKAVAVPEPYINWRLNWGPVCNPP RCTQHSEGGLGTLTVKNAQPLDQGAYTCEAINVKGRVLATPDCIVRIVNIPAPEMQTQCNIVGSVSPIPDHTGRCQCKPL VVGLKCDSCSQGAFHLHEKAQQGCFKCFCFGVTDQCQSSSWYRTKDKLILNGDSRGVHISDINGQIHSSQFDYSKPGMVT FNEPSYQTMYWKLPTRFLGNKLTAYGGELSFDIQYSCAGSVNNEPLIVLRGNGITLVHRPIDTHMFTSDQIIRYAINTFE VNFEELDGRPATRENLMMVLANIDMMLIRATHCYGQQYTRLGDITWEIAVNRDTQERFALEVEHCSCPPGYTGLSCETCA PGYERSPQGPYLGTCIPVQHRVQCSTSGARSMHPGYDGKCQCKMYAVGTLCDRCPSNTFHLSPRNPQGCIPCFCSGVTQQ CTSASSYYRAQVAIDYRRGATDQLEITTSDAHSPFTPQSQAQITGNDITFVSFYEIPGQTLYWKMPKQFLGNKVTSYGGT LKYVFRYSCTGPLNIDADVILRGNDISLQYTNHQPIYADRENTIEVVLFEDHWQRMDGQLATREHLLMALADLDSLLIKM SYTDDCSSSSLISVSLDYAEPHATGGEIAYEVEQCQCPPGYIGTSCEDCAPGYSRTGGGLYLGLCERCECHGHASQCDKE HGFCLDCQHNTEGDQCERCKPGFTGDARRGTPHDCQPAATRPPCMCNNHSPRGCDSFGRCLLCEHNTEGYHCEQCKRGFY GDALRGTPFDCTPCPCPGTSDCFLDTYGQVQCRNCPAGLTGRLCEECAPGYTRSRSRARIDEGRICEPIGHVEETNIVFV PTPEAYGPPIRVQIDAPKNLHIPVGGRARWFCRVIGQRSAGIRLQWSKVGTAGLPSNAVQYDGELIINGVRESDAGQYRC TGSGDHQFATDDGTLNVEAKPRIPVIGRPPPVMIDPLEQTVNVNDMVTYRCWVPGLSSCELKWYKEDIGGQLPHGVYQTD GMLKIPHAQLEHAGSYICTASNEYGIGKSPPARLIVQKPIQRPRIDPQENTVAEGEPARFRCWVPGDPTAILTWKMKGNG PLPPGVQQHDGILNIPSAQRQHAGSYICSASDPIGYKPPIDSPVARLIVRPASNPLVDPPEQTVSENQPAQFRCWVPGNP TAILHWRRADGRPLGYGVSDNQGILSIPRAQMSDAGEYICSARSVDDGTPVDSSPARLDVQKPYELHTTEHSLMGEQSKN LQKPEVDPKHEMVYEGDPAMFRCWLPTNLNAHLKWSRADGTPLPNSAFDDGTGTLYYLRAHVSDSDFYVCKYITENGSKI LESDPVQLKVKPYEQRKEIKKLELPREAPMIDPMEQIVDEGESSQIRCFISDNKTNVILKWRKQNDELPIHATQKNGILF ITQTEINDAGNYICTMDDFRGTPIDSLPARINVRQHGKIPVVLPISLTVNKGDLVRFQCYLPDKHTQMLRWGFKEKNGPL PEGAYVYYGVLTIDKARLTDSGEYICTDDETLQSAAPVTLTVENTGDNNDSNDNDNGDDDSDEIQEIENIHDSDEFNNRM KQQQQHDNHDIKHGIMARNDYDEHGNNNDNNSNHDYDTNHHIVKYGGKPPRPIATPNDQVVKIGEVARFHCDPNSDTPAT IRWGYETPDGPLRGDVVPEGNDLIIHSADHSHAGEYICIATNQYGTGEAEPVRLHVTEKEEPPTARVVPRAWNGQPGDKH QFHCITTGSPKPTIIWTGPSGEALPDDVTDIGGGFLDFQNARADMNGDYTCTATNIVGEASDYGSVNIGPSLTVRTSPPG PRIVLTVGEPLEVKCEAFGEPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPSIGLGNAGVYTCRGSNIQASAKKDI YIEVVEPSKVATVAILGGSTQWFEPGRSADLICTATGSEIVDRIQWVKVDGALPDDAKETELGILHLPRFRKSDSGEYEC RGYRHNELVGSNRVTIYATNLAPLDTARVEIDSPAVRVIDQGESIKLTCTVEGGDISGINYEWALLRGGNIIRQYSEDST LVIKKADPWNDYGVYRCEVEDDDGELIGQAYTAVTIGFTDPSNARVVKFDEKSSATIECPVYAIPGATVTWEKEDGELPP GAKMIGNKLIIDEFDDDAIGMYVCKVDIHGKQVEGYVKAEIYVPDTIIQVLLEPSSESISLGDRAWFDCKVTGDPDAEIT WTKEGEDELPDNTQVMGNRLLFVNVREDNGGIYKCHAKTKAGPLETRNVLNVGIAKHEIPNKSIQRIKESAPVITAAIGE EIELRCPATGAPGVYGEVKWEKVNGELPYAYSIRQGILHLKDTKRTDEGIYRCIIRTDSGLATVTHVHLKVSDFVPLFGG DDYLELKPLTDEQWSDINMKISFKPKSPNGLLLYTARQNAKNPEEIINYLSVGLKNGHVIYRYNVGAGPAELMSTYPVVM DEWHKIELVNQPSQAALLVDEDDIIEQDNYYFNTGEGISNIVSVGGTKDKKIFERTMFEQPFIGTITSLIISDETINFGE NAIAKSANIQKDAACSLGLCQHNSICIPTNIHNGFVCDCSNVKGYEGEFCERKILKCSHVTCGSGTCEYRMDGTQFCNCP TGRYGDRCQLLETDNIIESVEFNGETSYIVLPKSKTLRNFSLKMEIVPRSTNDQLLAYQASDYNPKRSNYLAFAIRRGKF VYFYSSADGNIEIESPDDVMINVPYHIDLKRFGNRAEVRINGTKVPTRGKLSTFLPGTNLFIGGIPSGITVNPRIGGAAS FRGCISKIVLNGMDINLTEILKKSSHDVTICKPYTTEEDVDIHVPFVWTTSIPTTRTTIRITTSKYSQMKPIESTDEMAD EIKVTDAMITGPEEIRVTDAVITESCTDNDNCSVRCTPDICGDHGDCEIINGTHIACSCRDYYDGPNCEIFKPIEHAAKF DGKAFIVFSIDDFPHLTSEHEESLSLRFKTSASSGLIFWQGQPFGTPLKGDDYLSIGLSDGHLVFSYELGGGASHLISAE VVNDDKEHQLQIWRKGREGKLIIDDGAPIIGSSFGIVAMLNVDGDVYIGGVPDLNSMTGGLHEENFIGCIGDIIFNGIKM DLMANAIDGRNVKPCDQWMIKKKWLRNGKYQ
view sequence (3391 aa)
>Bma-UNC-52
MRELCRLRILTSPLVLVLLLLLNSIATVKAWNKWSFNKYQTVDDYYSPSVQITIYPTEENIYEGNDATFNCRARTSDGVT
HSEVRWTRYNAPMPNSAYEVDGRLKFSSAVSSDSGRYICSANIGGRTYDASAQLNVQRYGPQEFQNILPQTGLCRIDERA
CGNNECVKTDYVCDGEPDCRDRSDEQNCPSLRSCEPNEFMCTNGRCVQKMWLCDGDDDCGDNSDEQACSHRAASDGCATS
EFKCRDGRQCVPLSFHCDGTNDCQDGSDEIGCVQPTIVQPPETNKQVHAGGTFQLTCKAVAVPEPYINWRLNWGPVCNPP
RCTQHSEGGLGTLTVKNAQPLDQGAYTCEAINVKGRVLATPDCIVRIVNIPAPEMQTQCNIVGSVSPIPDHTGRCQCKPL
VVGLKCDSCSQGAFHLHEKAQQGCFKCFCFGVTDQCQSSSWYRTKDKLILNGDSRGVHISDINGQIHSSQFDYSKPGMVT
FNEPSYQTMYWKLPTRFLGNKLTAYGGELSFDIQYSCAGSVNNEPLIVLRGNGITLVHRPIDTHMFTSDQIIRYAINTFE
VNFEELDGRPATRENLMMVLANIDMMLIRATHCYGQQYTRLGDITWEIAVNRDTQERFALEVEHCSCPPGYTGLSCETCA
PGYERSPQGPYLGTCIPVQHRVQCSTSGARSMHPGYDGKCQCKMYAVGTLCDRCPSNTFHLSPRNPQGCIPCFCSGVTQQ
CTSASSYYRAQVAIDYRRGATDQLEITTSDAHSPFTPQSQAQITGNDITFVSFYEIPGQTLYWKMPKQFLGNKVTSYGGT
LKYVFRYSCTGPLNIDADVILRGNDISLQYTNHQPIYADRENTIEVVLFEDHWQRMDGQLATREHLLMALADLDSLLIKM
SYTDDCSSSSLISVSLDYAEPHATGGEIAYEVEQCQCPPGYIGTSCEDCAPGYSRTGGGLYLGLCERCECHGHASQCDKE
HGFCLDCQHNTEGDQCERCKPGFTGDARRGTPHDCQPAATRPPCMCNNHSPRGCDSFGRCLLCEHNTEGYHCEQCKRGFY
GDALRGTPFDCTPCPCPGTSDCFLDTYGQVQCRNCPAGLTGRLCEECAPGYTRSRSRARIDEGRICEPIGHVEETNIVFV
PTPEAYGPPIRVQIDAPKNLHIPVGGRARWFCRVIGQRSAGIRLQWSKVGTAGLPSNAVQYDGELIINGVRESDAGQYRC
TGSGDHQFATDDGTLNVEAKPRIPVIGRPPPVMIDPLEQTVNVNDMVTYRCWVPGLSSCELKWYKEDIGGQLPHGVYQTD
GMLKIPHAQLEHAGSYICTASNEYGIGKSPPARLIVQKPIQRPRIDPQENTVAEGEPARFRCWVPGDPTAILTWKMKGNG
PLPPGVQQHDGILNIPSAQRQHAGSYICSASDPIGYKPPIDSPVARLIVRPASNPLVDPPEQTVSENQPAQFRCWVPGNP
TAILHWRRADGRPLGYGVSDNQGILSIPRAQMSDAGEYICSARSVDDGTPVDSSPARLDVQKPYELHTTEHSLMGEQSKN
LQKPEVDPKHEMVYEGDPAMFRCWLPTNLNAHLKWSRADGTPLPNSAFDDGTGTLYYLRAHVSDSDFYVCKYITENGSKI
LESDPVQLKVKPYEQRKEIKKLELPREAPMIDPMEQIVDEGESSQIRCFISDNKTNVILKWRKQNDELPIHATQKNGILF
ITQTEINDAGNYICTMDDFRGTPIDSLPARINVRQHGKIPVVLPISLTVNKGDLVRFQCYLPDKHTQMLRWGFKEKNGPL
PEGAYVYYGVLTIDKARLTDSGEYICTDDETLQSAAPVTLTVENTGDNNDSNDNDNGDDDSDEIQEIENIHDSDEFNNRM
KQQQQHDNHDIKHGIMARNDYDEHGNNNDNNSNHDYDTNHHIVKYGGKPPRPIATPNDQVVKIGEVARFHCDPNSDTPAT
IRWGYETPDGPLRGDVVPEGNDLIIHSADHSHAGEYICIATNQYGTGEAEPVRLHVTEKEEPPTARVVPRAWNGQPGDKH
QFHCITTGSPKPTIIWTGPSGEALPDDVTDIGGGFLDFQNARADMNGDYTCTATNIVGEASDYGSVNIGPSLTVRTSPPG
PRIVLTVGEPLEVKCEAFGEPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPSIGLGNAGVYTCRGSNIQASAKKDI
YIEVVEPSKVATVAILGGSTQWFEPGRSADLICTATGSEIVDRIQWVKVDGALPDDAKETELGILHLPRFRKSDSGEYEC
RGYRHNELVGSNRVTIYATNLAPLDTARVEIDSPAVRVIDQGESIKLTCTVEGGDISGINYEWALLRGGNIIRQYSEDST
LVIKKADPWNDYGVYRCEVEDDDGELIGQAYTAVTIGFTDPSNARVVKFDEKSSATIECPVYAIPGATVTWEKEDGELPP
GAKMIGNKLIIDEFDDDAIGMYVCKVDIHGKQVEGYVKAEIYVPDTIIQVLLEPSSESISLGDRAWFDCKVTGDPDAEIT
WTKEGEDELPDNTQVMGNRLLFVNVREDNGGIYKCHAKTKAGPLETRNVLNVGIAKHEIPNKSIQRIKESAPVITAAIGE
EIELRCPATGAPGVYGEVKWEKVNGELPYAYSIRQGILHLKDTKRTDEGIYRCIIRTDSGLATVTHVHLKVSDFVPLFGG
DDYLELKPLTDEQWSDINMKISFKPKSPNGLLLYTARQNAKNPEEIINYLSVGLKNGHVIYRYNVGAGPAELMSTYPVVM
DEWHKIELVNQPSQAALLVDEDDIIEQDNYYFNTGEGISNIVSVGGTKDKKIFERTMFEQPFIGTITSLIISDETINFGE
NAIAKSANIQKDAACSLGLCQHNSICIPTNIHNGFVCDCSNVKGYEGEFCERKILKCSHVTCGSGTCEYRMDGTQFCNCP
TGRYGDRCQLLETDNIIESVEFNGETSYIVLPKSKTLRNFSLKMEIVPRSTNDQLLAYQASDYNPKRSNYLAFAIRRGKF
VYFYSSADGNIEIESPDDVMINVPYHIDLKRFGNRAEVRINGTKVPTRGKLSTFLPGTNLFIGGIPSGITVNPRIGGAAS
FRGCISKIVLNGMDINLTEILKKSSHDVTICKPYTTEEDVDIHVPFVWTTSIPTTRTTIRITTSKYSQMKPIESTDEMAD
EIKVTDAMITGPEEIRVTDAVITESCTDNDNCSVRCTPDICGDHGDCEIINGTHIACSCRDYYDGPNCEIFKPIEHAAKF
DGKAFIVFSIDDFPHLTSEHEESLSLRFKTSASSGLIFWQGQPFGTPLKGDDYLSIGLSDGHLVFSYELGGGASHLISAE
VVNDDKEHQLQIWRKGREGKLIIDDGAPIIGSSFGIVAMLNVDGDVYIGGVPDLNSMTGGLHEENFIGCIGDIIFNGIKM
DLMANAIDGRNVKPCDQWMIKKKWLRNGKYQ
Estimated Isoelectric Point:
5.12262725830078
Estimated Molecular Weight:
375.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr215
Lys147
Gln139
Leu210
Gly290
Met53
Ser211
Tyr125
His89
Glu211
Arg172
Cys137
Phe95
Pro216
Val200
Asn170
Ala185
Ile242
Trp42
Asp242