Sequence:
download
BM38703sequence.fasta
>Bma-GLD-2, isoform b MPMSSIWPYCYYHYSVNPKRSFCQQAITTQRRPVDAMLFTISQIPGTSTDVTQSRLDKQCDTSPFPNGISRSRSTASSTY ADSTSSGIDSRDSYQQQEESGSLLSYVAVASSSDSNHYLPEITCLSDSDYDLVNIDFYPRRQYFPSSKQIPKYSVQPSRL QSHASSDFLIAAYSSCYPSALKLCNLRRAYLARKEKSSSAVNLNIINPASTWFSVYQSPNCVLIPLKEIETYIHCLESFS TQLVHSQTTSIQVHPVSEFEATRFTSDLSSLPTNTKNITSEVLRACDSIRTSGENVSSVSLETDSRTSNIPESANNENDH PTLSTDKPKKLVQDHFLDEDSLLENLPKFEYSSASGLPCGLTGNINWLQSKSPNAKSDFNICGSDGCVSKQRKHVLQARN IHRSSVISSRANEGRSGSKSGGLPPMPPYHQLNNNNWRRQSQNGPLSKNYSTRPFSTSDGFIRNRERNSYDKFCMSNMDR NRDRSQCNSSDKSFASRMNNVYRSANRSSFISHDKNGLTYHDVNTENSFSLLATEDRRGRGIAASDCPLHRNMKRNGSNK SRNSPPVYLALKSHREFDIDSNEVETVGSALKVERLERHHSPKRNIEKMQRTTQDIEQLTGLFCERVAVCGGGEVSYQSD SSPATAGFCDRVFVNDKKIAERSVSLAGGITEELPQQDKAQTADVELDFSAQRPLESHIVDNEGFELSKLDVLSEEIWYY HKAITQTESVLNRKLHLRDVLYYAISPVFPMCGLYVVGSSLNGFGTNSSDMDLCLMITNKDLDQRTDAVVVLNMIQSALA ETKWVSHMQLILAKVPILRIRFYEPFTDITVDLNANNSVAIRNTHLLCYYSSFDWRVRPLVSVVKEWAKRRDINDANRSS FTSYSLVLMVIHYLQCGLKQPILPSLQVVYPKRFSASADVRSLNVSSHLEPPPGWVTNETITLGELLIGFLEYYAFKFDY LKDAISVRLGSKTERTVVARQPSPYNSNIAQWNCICIEEPFTLSNTAHSVHNQMVFDAIRQAFVDGCCELDSNRDLRAFL DVGPINVSIGSSVGSSAQLSILAQSEVGSPTTADSGDVTLTSKPLLTVSPQSNKLGYHLIGRDESLPLDAESEMELETAV TISLDERICVEQDMSQKNAPEICENEVTDVARNEGTPKSTNDFTENVLSSGAGLDTTSSIFVDGPPANSEQISKAVLSEC QPKQLQVESHNEKLHVDSALSFEALTKQKSAVEQQQFAGKVIVQRRRKTSRRMHGSMGCAGRNRLNKSSLGQPVVRMSYR SGTASS
view sequence (1286 aa)
>Bma-GLD-2, isoform b
MPMSSIWPYCYYHYSVNPKRSFCQQAITTQRRPVDAMLFTISQIPGTSTDVTQSRLDKQCDTSPFPNGISRSRSTASSTY
ADSTSSGIDSRDSYQQQEESGSLLSYVAVASSSDSNHYLPEITCLSDSDYDLVNIDFYPRRQYFPSSKQIPKYSVQPSRL
QSHASSDFLIAAYSSCYPSALKLCNLRRAYLARKEKSSSAVNLNIINPASTWFSVYQSPNCVLIPLKEIETYIHCLESFS
TQLVHSQTTSIQVHPVSEFEATRFTSDLSSLPTNTKNITSEVLRACDSIRTSGENVSSVSLETDSRTSNIPESANNENDH
PTLSTDKPKKLVQDHFLDEDSLLENLPKFEYSSASGLPCGLTGNINWLQSKSPNAKSDFNICGSDGCVSKQRKHVLQARN
IHRSSVISSRANEGRSGSKSGGLPPMPPYHQLNNNNWRRQSQNGPLSKNYSTRPFSTSDGFIRNRERNSYDKFCMSNMDR
NRDRSQCNSSDKSFASRMNNVYRSANRSSFISHDKNGLTYHDVNTENSFSLLATEDRRGRGIAASDCPLHRNMKRNGSNK
SRNSPPVYLALKSHREFDIDSNEVETVGSALKVERLERHHSPKRNIEKMQRTTQDIEQLTGLFCERVAVCGGGEVSYQSD
SSPATAGFCDRVFVNDKKIAERSVSLAGGITEELPQQDKAQTADVELDFSAQRPLESHIVDNEGFELSKLDVLSEEIWYY
HKAITQTESVLNRKLHLRDVLYYAISPVFPMCGLYVVGSSLNGFGTNSSDMDLCLMITNKDLDQRTDAVVVLNMIQSALA
ETKWVSHMQLILAKVPILRIRFYEPFTDITVDLNANNSVAIRNTHLLCYYSSFDWRVRPLVSVVKEWAKRRDINDANRSS
FTSYSLVLMVIHYLQCGLKQPILPSLQVVYPKRFSASADVRSLNVSSHLEPPPGWVTNETITLGELLIGFLEYYAFKFDY
LKDAISVRLGSKTERTVVARQPSPYNSNIAQWNCICIEEPFTLSNTAHSVHNQMVFDAIRQAFVDGCCELDSNRDLRAFL
DVGPINVSIGSSVGSSAQLSILAQSEVGSPTTADSGDVTLTSKPLLTVSPQSNKLGYHLIGRDESLPLDAESEMELETAV
TISLDERICVEQDMSQKNAPEICENEVTDVARNEGTPKSTNDFTENVLSSGAGLDTTSSIFVDGPPANSEQISKAVLSEC
QPKQLQVESHNEKLHVDSALSFEALTKQKSAVEQQQFAGKVIVQRRRKTSRRMHGSMGCAGRNRLNKSSLGQPVVRMSYR
SGTASS
Estimated Isoelectric Point:
6.53189849853516
Estimated Molecular Weight:
143.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr72
Lys56
Gln59
Leu108
Gly56
Met21
Ser178
Tyr42
His30
Glu70
Arg80
Cys30
Phe43
Pro62
Val84
Asn78
Ala72
Ile62
Trp10
Asp73