Sequence:
download
BM38655sequence.fasta
>Bma-GLD-2, isoform a MLFTISQIPGTSTDVTQSRLDKQCDTSPFPNGISRSRSTASSTYADSTSSGIDSRDSYQQQEESGSLLSYVAVASSSDSN HYLPEITCLSDSDYDLVNIDFYPRRQYFPSSKQIPKYSVQPSRLQSHASSDFLIAAYSSCYPSALKLCNLRRAYLARKEK SSSAVNLNIINPASTWFSVYQSPNCVLIPLKEIETYIHCLESFSTQLVHSQTTSIQVHPVSEFEATRFTSDLSSLPTNTK NITSEVLRACDSIRTSGENVSSVSLETDSRTSNIPESANNENDHPTLSTDKPKKLVQDHFLDEDSLLENLPKFEYSSASG LPCGLTGNINWLQSKSPNAKSDFNICGSDGCVSKQRKHVLQARNIHRSSVISSRANEGRSGSKSGGLPPMPPYHQLNNNN WRRQSQNGPLSKNYSTRPFSTSDGFIRNRERNSYDKFCMSNMDRNRDRSQCNSSDKSFASRMNNVYRSANRSSFISHDKN GLTYHDVNTENSFSLLATEDRRGRGIAASDCPLHRNMKRNGSNKSRNSPPVYLALKSHREFDIDSNEVETVGSALKVERL ERHHSPKRNIEKMQRTTQDIEQLTGLFCERVAVCGGGEVSYQSDSSPATAGFCDRVFVNDKKIAERSVSLAGGITEELPQ QDKAQTADVELDFSAQRPLESHIVDNEGFELSKLDVLSEEIWYYHKAITQTESVLNRKLHLRDVLYYAISPVFPMCGLYV VGSSLNGFGTNSSDMDLCLMITNKDLDQRTDAVVVLNMIQSALAETKWVSHMQLILAKVPILRIRFYEPFTDITVDLNAN NSVAIRNTHLLCYYSSFDWRVRPLVSVVKEWAKRRDINDANRSSFTSYSLVLMVIHYLQCGLKQPILPSLQVVYPKRFSA SADVRSLNVSSHLEPPPGWVTNETITLGELLIGFLEYYAFKFDYLKDAISVRLGSKTERTVVARQPSPYNSNIAQWNCIC IEEPFTLSNTAHSVHNQMVFDAIRQAFVDGCCELDSNRDLRAFLDVGPINVSIGSSVGSSAQLSILAQSEVGSPTTADSG DVTLTSKPLLTVSPQSNKLGYHLIGRDESLPLDAESEMELETAVTISLDERICVEQDMSQKNAPEICENEVTDVARNEGT PKSTNDFTENVLSSGAGLDTTSSIFVDGPPANSEQISKAVLSECQPKQLQVESHNEKLHVDSALSFEALTKQKSAVEQQQ FAGKVIVQRRRKTSRRMHGSMGCAGRNRLNKSSLGQPVVRMSYRSGTASS
view sequence (1250 aa)
>Bma-GLD-2, isoform a
MLFTISQIPGTSTDVTQSRLDKQCDTSPFPNGISRSRSTASSTYADSTSSGIDSRDSYQQQEESGSLLSYVAVASSSDSN
HYLPEITCLSDSDYDLVNIDFYPRRQYFPSSKQIPKYSVQPSRLQSHASSDFLIAAYSSCYPSALKLCNLRRAYLARKEK
SSSAVNLNIINPASTWFSVYQSPNCVLIPLKEIETYIHCLESFSTQLVHSQTTSIQVHPVSEFEATRFTSDLSSLPTNTK
NITSEVLRACDSIRTSGENVSSVSLETDSRTSNIPESANNENDHPTLSTDKPKKLVQDHFLDEDSLLENLPKFEYSSASG
LPCGLTGNINWLQSKSPNAKSDFNICGSDGCVSKQRKHVLQARNIHRSSVISSRANEGRSGSKSGGLPPMPPYHQLNNNN
WRRQSQNGPLSKNYSTRPFSTSDGFIRNRERNSYDKFCMSNMDRNRDRSQCNSSDKSFASRMNNVYRSANRSSFISHDKN
GLTYHDVNTENSFSLLATEDRRGRGIAASDCPLHRNMKRNGSNKSRNSPPVYLALKSHREFDIDSNEVETVGSALKVERL
ERHHSPKRNIEKMQRTTQDIEQLTGLFCERVAVCGGGEVSYQSDSSPATAGFCDRVFVNDKKIAERSVSLAGGITEELPQ
QDKAQTADVELDFSAQRPLESHIVDNEGFELSKLDVLSEEIWYYHKAITQTESVLNRKLHLRDVLYYAISPVFPMCGLYV
VGSSLNGFGTNSSDMDLCLMITNKDLDQRTDAVVVLNMIQSALAETKWVSHMQLILAKVPILRIRFYEPFTDITVDLNAN
NSVAIRNTHLLCYYSSFDWRVRPLVSVVKEWAKRRDINDANRSSFTSYSLVLMVIHYLQCGLKQPILPSLQVVYPKRFSA
SADVRSLNVSSHLEPPPGWVTNETITLGELLIGFLEYYAFKFDYLKDAISVRLGSKTERTVVARQPSPYNSNIAQWNCIC
IEEPFTLSNTAHSVHNQMVFDAIRQAFVDGCCELDSNRDLRAFLDVGPINVSIGSSVGSSAQLSILAQSEVGSPTTADSG
DVTLTSKPLLTVSPQSNKLGYHLIGRDESLPLDAESEMELETAVTISLDERICVEQDMSQKNAPEICENEVTDVARNEGT
PKSTNDFTENVLSSGAGLDTTSSIFVDGPPANSEQISKAVLSECQPKQLQVESHNEKLHVDSALSFEALTKQKSAVEQQQ
FAGKVIVQRRRKTSRRMHGSMGCAGRNRLNKSSLGQPVVRMSYRSGTASS
Estimated Isoelectric Point:
6.32927703857422
Estimated Molecular Weight:
138.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr70
Lys55
Gln56
Leu108
Gly56
Met19
Ser174
Tyr38
His29
Glu70
Arg77
Cys28
Phe42
Pro58
Val82
Asn77
Ala70
Ile60
Trp9
Asp72