Sequence:
download
BM38630sequence.fasta
>Bma-UNC-31, isoform c MARRQLKVTRQELSRIKDRFRLFLTGETQIAADEAFTKTVESYFEVFLKSERIQKVVQAGGFSQYDFREVFRCNTEKKIK TLTELDGTSRETMLNNWMTKFDIIIRGDDDIVQSRQTRNRLRGMNQSNAGLTLLKDQLYDIFQQILSVKKFEHQIIFNAL QLDNPDEQAAAIRREVATREEALRDMSKMKKLMPKFVVKDMETLFIDETRQSINLLISNLESVPVTPRGQSVISRKKDSK GRSSVSSKAKRSRSIEDLSLFNSLKRRTSSSSLNKADSDDDVSLTKSDVILTFNMEVVVMEVQNLKSVASNKLVYCTMEV DGCPKLQTDHTEASKSSWDTQGDFTTKHPLPTVKVKLYTELKSLVAFEDKELGKVVIRPTPNCSRTPEWYNMTVPKNSPD TNLKIRIAIRVEKPPNLKYCGYCYALGRIAWKKWKKRFFCLVQVSQYAFAMCSYREKKTDPAEFIQLDGFTIDYMPEPDS DLYNQGGKYFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSSVVLSKAQGFADKASKHGMDELIQADP INFDHDHLFSKLQSLTLDFRLNEPVCSLGWLSPGQVFVLDEYCARYMVRGCHRHVSLLNDLLNKADEGFLIDPTLMHYSF AFCASHVHGNRPDGVGTVTLEEKEKFQDVKERLRTLLEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKDVVSPVPPEE VRNVIRKCLQDAALVNYTRICNEAKLEQHMGMDVSPQQRIEDMMRVTEFCIDLLRENEEHHGDAFTWFSDLLADHSEIFW SLYSVDLDAALNVQPPDSWDSFPLFQLLNDFLSNNSHLKNGIFHTKLIQQFSTKVVRYVDLMEQSIVQSIERGFARERWE VHKDGCATSEDTYWKLDALQIFIHDLNWPEEEFSKYLQIRMKALTSEMINKCTNCTYQCFDSYMQRARKSTDYILPSEVC VMINVIFSSKSRAAKIAIDSGEYKYHSKLDETLDTMLKDMETCIEDKLLSVLEYVLSRLARYDEGNPIGAILSIAPRPTT IFNKMKNIVGEQGIVGNLTGSATSSPQNPKPIVSQPQNSGHHGHSYVTFMRICTEQLRQVVVDELWVNALFEHWYEDQMK MVNDWLTERLQQSLSQYQLTCLSFMVKKIYSDSELQGVDDERLNNKTYQSIMRRLQIEEANCALNDNASGHANTSISNHA LIDNATQAVTNVSSLVEGASAKMFSLFK
view sequence (1228 aa)
>Bma-UNC-31, isoform c
MARRQLKVTRQELSRIKDRFRLFLTGETQIAADEAFTKTVESYFEVFLKSERIQKVVQAGGFSQYDFREVFRCNTEKKIK
TLTELDGTSRETMLNNWMTKFDIIIRGDDDIVQSRQTRNRLRGMNQSNAGLTLLKDQLYDIFQQILSVKKFEHQIIFNAL
QLDNPDEQAAAIRREVATREEALRDMSKMKKLMPKFVVKDMETLFIDETRQSINLLISNLESVPVTPRGQSVISRKKDSK
GRSSVSSKAKRSRSIEDLSLFNSLKRRTSSSSLNKADSDDDVSLTKSDVILTFNMEVVVMEVQNLKSVASNKLVYCTMEV
DGCPKLQTDHTEASKSSWDTQGDFTTKHPLPTVKVKLYTELKSLVAFEDKELGKVVIRPTPNCSRTPEWYNMTVPKNSPD
TNLKIRIAIRVEKPPNLKYCGYCYALGRIAWKKWKKRFFCLVQVSQYAFAMCSYREKKTDPAEFIQLDGFTIDYMPEPDS
DLYNQGGKYFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSSVVLSKAQGFADKASKHGMDELIQADP
INFDHDHLFSKLQSLTLDFRLNEPVCSLGWLSPGQVFVLDEYCARYMVRGCHRHVSLLNDLLNKADEGFLIDPTLMHYSF
AFCASHVHGNRPDGVGTVTLEEKEKFQDVKERLRTLLEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKDVVSPVPPEE
VRNVIRKCLQDAALVNYTRICNEAKLEQHMGMDVSPQQRIEDMMRVTEFCIDLLRENEEHHGDAFTWFSDLLADHSEIFW
SLYSVDLDAALNVQPPDSWDSFPLFQLLNDFLSNNSHLKNGIFHTKLIQQFSTKVVRYVDLMEQSIVQSIERGFARERWE
VHKDGCATSEDTYWKLDALQIFIHDLNWPEEEFSKYLQIRMKALTSEMINKCTNCTYQCFDSYMQRARKSTDYILPSEVC
VMINVIFSSKSRAAKIAIDSGEYKYHSKLDETLDTMLKDMETCIEDKLLSVLEYVLSRLARYDEGNPIGAILSIAPRPTT
IFNKMKNIVGEQGIVGNLTGSATSSPQNPKPIVSQPQNSGHHGHSYVTFMRICTEQLRQVVVDELWVNALFEHWYEDQMK
MVNDWLTERLQQSLSQYQLTCLSFMVKKIYSDSELQGVDDERLNNKTYQSIMRRLQIEEANCALNDNASGHANTSISNHA
LIDNATQAVTNVSSLVEGASAKMFSLFK
Estimated Isoelectric Point:
6.36495208740234
Estimated Molecular Weight:
141.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr70
Lys87
Gln62
Leu118
Gly48
Met36
Ser99
Tyr37
His27
Glu83
Arg69
Cys25
Phe58
Pro43
Val81
Asn58
Ala66
Ile63
Trp16
Asp82