Sequence:
download
BM38585sequence.fasta
>Bm7580, isoform b MLGASSSEEDDDDNLVNDNDDTSEILCLRRHQFPLSSSPRSMSPAPSDSASQANSLHRGDSLHTKRKDSEASYGAVVMKT SQSRQVTLQPKPVFNQSSQEISDDDDEFASNEQSTPANAIIDSTAEISKEEEEKMKAEVEEEERKQKLKLYVFVAKCIAY HFNAKQPTDMARRQLKVTRQELSRIKDRFRLFLTGETQIAADEAFTKTVESYFEVFLKSERIQKVVQAGGFSQYDFREVF RCNTEKKIKTLTELDGTSRETMLNNWMTKFDIIIRGDDDIVQSRQTRNRLRGMNQSNAGLTLLKDQLYDIFQQILSVKKF EHQIIFNALQLDNPDEQAAAIRREVATREEALRDMSKMKKLMPKFVVKDMETLFIDETRQSINLLISNLESVPVTPRGQS VISRKKDSKGRSRSRSIEDLSLFNSLKRRTSSSSLNKADSDDDVSLTKSDVILTFNMEVVVMEVQNLKSVASNKLVYCTM EVDGCPKLQTDHTEASKSSWDTQGDFTTKHPLPTVKVKLYTELKSLVAFEDKELGKVVIRPTPNCSRTPEWYNMTVPKNS PDTNLKIRIAIRVEKPPNLKYCGYCYALGRIAWKKWKKRFFCLVQVSQYAFAMCSYREKKTDPAEFIQLDGFTIDYMPEP DSDLYNQGGKYFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSSVVLSKAQGFADKASKHGMDELIQA DPINFDHDHLFSKLQSLTLDFRLNEPVCSLGWLSPGQVFVLDEYCARYMVRGCHRHVSLLNDLLNKADEGFLIDPTLMHY SFAFCASHVHGNRPDGVGTVTLEEKEKFQDVKERLRTLLEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKDVVSPVPP EEVRNVIRKCLQDAALVNYTRICNEAKLEQHMGMDVSPQQRIEDMMRVTEFCIDLLRENEEHHGDAFTWFSDLLADHSEI FWSLYSVDLDAALNVQPPDSWDSFPLFQLLNDFLSNNSHLKNGIFHTKLIQQFSTKVVRYVDLMEQSIVQSIERGFARER WEVHKDGCATSEDTYWKLDALQIFIHDLNWPEEEFSKYLQIRMKALTSEMINKCTNCTYQCFDSYMQRARKSTDYILPSE VCVMINVIFSSKSRAAKIAIDSGEYKYHSKLDETLDTMLKDMETCIEDKLLSVLEYVLSRLARYDEGNPIGAILSIAPRP TTIFNKMKNIVGEQGIVGNLTGSATSSPQNPKPIVSQPQNSGHHGHSYVTFMRICTEQLRQVVVDELWVNALFEHWYEDQ MKMVNDWLTERLQQSLSQYQLTCLSFMVKKIYSDSELQGVDDERLNNKTYQSIMRRLQIEEANCALNDNASGHANTSISN HALIDNATQAVTNVSSLVEGASAKMFSLFK
view sequence (1390 aa)
>Bm7580, isoform b
MLGASSSEEDDDDNLVNDNDDTSEILCLRRHQFPLSSSPRSMSPAPSDSASQANSLHRGDSLHTKRKDSEASYGAVVMKT
SQSRQVTLQPKPVFNQSSQEISDDDDEFASNEQSTPANAIIDSTAEISKEEEEKMKAEVEEEERKQKLKLYVFVAKCIAY
HFNAKQPTDMARRQLKVTRQELSRIKDRFRLFLTGETQIAADEAFTKTVESYFEVFLKSERIQKVVQAGGFSQYDFREVF
RCNTEKKIKTLTELDGTSRETMLNNWMTKFDIIIRGDDDIVQSRQTRNRLRGMNQSNAGLTLLKDQLYDIFQQILSVKKF
EHQIIFNALQLDNPDEQAAAIRREVATREEALRDMSKMKKLMPKFVVKDMETLFIDETRQSINLLISNLESVPVTPRGQS
VISRKKDSKGRSRSRSIEDLSLFNSLKRRTSSSSLNKADSDDDVSLTKSDVILTFNMEVVVMEVQNLKSVASNKLVYCTM
EVDGCPKLQTDHTEASKSSWDTQGDFTTKHPLPTVKVKLYTELKSLVAFEDKELGKVVIRPTPNCSRTPEWYNMTVPKNS
PDTNLKIRIAIRVEKPPNLKYCGYCYALGRIAWKKWKKRFFCLVQVSQYAFAMCSYREKKTDPAEFIQLDGFTIDYMPEP
DSDLYNQGGKYFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSSVVLSKAQGFADKASKHGMDELIQA
DPINFDHDHLFSKLQSLTLDFRLNEPVCSLGWLSPGQVFVLDEYCARYMVRGCHRHVSLLNDLLNKADEGFLIDPTLMHY
SFAFCASHVHGNRPDGVGTVTLEEKEKFQDVKERLRTLLEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKDVVSPVPP
EEVRNVIRKCLQDAALVNYTRICNEAKLEQHMGMDVSPQQRIEDMMRVTEFCIDLLRENEEHHGDAFTWFSDLLADHSEI
FWSLYSVDLDAALNVQPPDSWDSFPLFQLLNDFLSNNSHLKNGIFHTKLIQQFSTKVVRYVDLMEQSIVQSIERGFARER
WEVHKDGCATSEDTYWKLDALQIFIHDLNWPEEEFSKYLQIRMKALTSEMINKCTNCTYQCFDSYMQRARKSTDYILPSE
VCVMINVIFSSKSRAAKIAIDSGEYKYHSKLDETLDTMLKDMETCIEDKLLSVLEYVLSRLARYDEGNPIGAILSIAPRP
TTIFNKMKNIVGEQGIVGNLTGSATSSPQNPKPIVSQPQNSGHHGHSYVTFMRICTEQLRQVVVDELWVNALFEHWYEDQ
MKMVNDWLTERLQQSLSQYQLTCLSFMVKKIYSDSELQGVDDERLNNKTYQSIMRRLQIEEANCALNDNASGHANTSISN
HALIDNATQAVTNVSSLVEGASAKMFSLFK
Estimated Isoelectric Point:
5.78614044189453
Estimated Molecular Weight:
159.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr77
Lys97
Gln72
Leu128
Gly51
Met40
Ser121
Tyr40
His31
Glu100
Arg76
Cys27
Phe63
Pro51
Val88
Asn66
Ala79
Ile69
Trp16
Asp98