Sequence:
download
BM38500sequence.fasta
>Bm7580, isoform a MLGASSSEEDDDDNLVNDNDDTSEILCLRRHQFPLSSSPRSMSPAPSDSASQANSLHRGDSLHTKRKDSEASYGAVVMKT SQSRQVTLQPKPVFNQSSQEISDDDDEFASNEQSTPANAIIDSTAEISKEEEEKMKAEVEEEERKQKLKLYVFVAKCIAY HFNAKQPTDMARRQLKVTRQELSRIKDRFRLFLTGETQIAADEAFTKTVESYFEVFLKSERIQKVVQAGGFSQYDFREVF RCNTEKKIKTLTELDGTSRETMLNNWMTKFDIIIRGDDDIVQSRQTRNRLRGMNQSNAGLTLLKDQLYDIFQQILSVKKF EHQIIFNALQLDNPDEQAAAIRREVATREEALRDMSKMKKLMPKFVVKDMETLFIDETRQSINLLISNLESVPVTPRGQS VISRKKDSKGRSSVSSKAKRSRSIEDLSLFNSLKRRTSSSSLNKADSDDDVSLTKSDVILTFNMEVVVMEVQNLKSVASN KLVYCTMEVDGCPKLQTDHTEASKSSWDTQGDFTTKHPLPTVKVKLYTELKSLVAFEDKELGKVVIRPTPNCSRTPEWYN MTVPKNSPDTNLKIRIAIRVEKPPNLKYCGYCYALGRIAWKKWKKRFFCLVQVSQYAFAMCSYREKKTDPAEFIQLDGFT IDYMPEPDSDLYNQGGKYFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSSVVLSKAQGFADKASKHG MDELIQADPINFDHDHLFSKLQSLTLDFRLNEPVCSLGWLSPGQVFVLDEYCARYMVRGCHRHVSLLNDLLNKADEGFLI DPTLMHYSFAFCASHVHGNRPDGVGTVTLEEKEKFQDVKERLRTLLEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKD VVSPVPPEEVRNVIRKCLQDAALVNYTRICNEAKLEQHMGMDVSPQQRIEDMMRVTEFCIDLLRENEEHHGDAFTWFSDL LADHSEIFWSLYSVDLDAALNVQPPDSWDSFPLFQLLNDFLSNNSHLKNGIFHTKLIQQFSTKVVRYVDLMEQSIVQSIE RGFARERWEVHKDGCATSEDTYWKLDALQIFIHDLNWPEEEFSKYLQIRMKALTSEMINKCTNCTYQCFDSYMQRARKST DYILPSEVCVMINVIFSSKSRAAKIAIDSGEYKYHSKLDETLDTMLKDMETCIEDKLLSVLEYVLSRLARYDEGNPIGAI LSIAPRPTTIFNKMKNIVGEQGIVGNLTGSATSSPQNPKPIVSQPQNSGHHGHSYVTFMRICTEQLRQVVVDELWVNALF EHWYEDQMKMVNDWLTERLQQSLSQYQLTCLSFMVKKIYSDSELQGVDDERLNNKTYQSIMRRLQIEEANCALNDNASGH ANTSISNHALIDNATQAVTNVSSLVEGASAKMFSLFK
view sequence (1397 aa)
>Bm7580, isoform a
MLGASSSEEDDDDNLVNDNDDTSEILCLRRHQFPLSSSPRSMSPAPSDSASQANSLHRGDSLHTKRKDSEASYGAVVMKT
SQSRQVTLQPKPVFNQSSQEISDDDDEFASNEQSTPANAIIDSTAEISKEEEEKMKAEVEEEERKQKLKLYVFVAKCIAY
HFNAKQPTDMARRQLKVTRQELSRIKDRFRLFLTGETQIAADEAFTKTVESYFEVFLKSERIQKVVQAGGFSQYDFREVF
RCNTEKKIKTLTELDGTSRETMLNNWMTKFDIIIRGDDDIVQSRQTRNRLRGMNQSNAGLTLLKDQLYDIFQQILSVKKF
EHQIIFNALQLDNPDEQAAAIRREVATREEALRDMSKMKKLMPKFVVKDMETLFIDETRQSINLLISNLESVPVTPRGQS
VISRKKDSKGRSSVSSKAKRSRSIEDLSLFNSLKRRTSSSSLNKADSDDDVSLTKSDVILTFNMEVVVMEVQNLKSVASN
KLVYCTMEVDGCPKLQTDHTEASKSSWDTQGDFTTKHPLPTVKVKLYTELKSLVAFEDKELGKVVIRPTPNCSRTPEWYN
MTVPKNSPDTNLKIRIAIRVEKPPNLKYCGYCYALGRIAWKKWKKRFFCLVQVSQYAFAMCSYREKKTDPAEFIQLDGFT
IDYMPEPDSDLYNQGGKYFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSSVVLSKAQGFADKASKHG
MDELIQADPINFDHDHLFSKLQSLTLDFRLNEPVCSLGWLSPGQVFVLDEYCARYMVRGCHRHVSLLNDLLNKADEGFLI
DPTLMHYSFAFCASHVHGNRPDGVGTVTLEEKEKFQDVKERLRTLLEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKD
VVSPVPPEEVRNVIRKCLQDAALVNYTRICNEAKLEQHMGMDVSPQQRIEDMMRVTEFCIDLLRENEEHHGDAFTWFSDL
LADHSEIFWSLYSVDLDAALNVQPPDSWDSFPLFQLLNDFLSNNSHLKNGIFHTKLIQQFSTKVVRYVDLMEQSIVQSIE
RGFARERWEVHKDGCATSEDTYWKLDALQIFIHDLNWPEEEFSKYLQIRMKALTSEMINKCTNCTYQCFDSYMQRARKST
DYILPSEVCVMINVIFSSKSRAAKIAIDSGEYKYHSKLDETLDTMLKDMETCIEDKLLSVLEYVLSRLARYDEGNPIGAI
LSIAPRPTTIFNKMKNIVGEQGIVGNLTGSATSSPQNPKPIVSQPQNSGHHGHSYVTFMRICTEQLRQVVVDELWVNALF
EHWYEDQMKMVNDWLTERLQQSLSQYQLTCLSFMVKKIYSDSELQGVDDERLNNKTYQSIMRRLQIEEANCALNDNASGH
ANTSISNHALIDNATQAVTNVSSLVEGASAKMFSLFK
Estimated Isoelectric Point:
5.85236358642578
Estimated Molecular Weight:
159.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr77
Lys99
Gln72
Leu128
Gly51
Met40
Ser124
Tyr40
His31
Glu100
Arg76
Cys27
Phe63
Pro51
Val89
Asn66
Ala80
Ile69
Trp16
Asp98