Sequence:
download
BM38490sequence.fasta
>Bma-RHEB-1 MANAIQRKIAVMGYPCVGKSSITLRFVYGNFPDAYDTTIEDIYTKSYKFNGKQFALQITDTAGQQEFSLFPRSCAIDIDG YILVYAIDDRKSFEIVQSIYDKIMENLGDKNIPIVVVGNKLDLHFNARHVSTEEGRQLAVAWNAAFLETSAKDNTSVEQI FDCLLREIEIANGNMKRNRNGCVLS
view sequence (185 aa)
>Bma-RHEB-1
MANAIQRKIAVMGYPCVGKSSITLRFVYGNFPDAYDTTIEDIYTKSYKFNGKQFALQITDTAGQQEFSLFPRSCAIDIDG
YILVYAIDDRKSFEIVQSIYDKIMENLGDKNIPIVVVGNKLDLHFNARHVSTEEGRQLAVAWNAAFLETSAKDNTSVEQI
FDCLLREIEIANGNMKRNRNGCVLS
Estimated Isoelectric Point:
5.43344879150391
Estimated Molecular Weight:
20.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys11
Gln8
Leu12
Gly11
Met4
Ser11
Tyr8
His2
Glu10
Arg9
Cys4
Phe10
Pro4
Val12
Asn13
Ala15
Ile18
Trp1
Asp13