Sequence:
download
BM37893sequence.fasta
>Bma-ITR-1 MLRNQHRLYNNKLSIAMSLDTFHNTSLHIGDVISLYAEDYSRPVEDRLEERLFPRTGFLSTLGLVDDRCIVEIGNGTPDS PPKKFRDCLFRVCPINRYAAQKQFWTEQKKFQVGESLFEEDMLKKLKHAADKEKEQNDMEYKKMLGANVQYGGTIQLLHV KSDKYLTVLKNSPAKLERNAMKVYLDKNGHEGSWFYVEPVYKHSFFGDNVNGGDRISLVPYSYCPIPNTTGHVKPQLHLS HLSLPDHPIGFEVNCSNELTEWQVLMFLQFDENQENIVKSGDVVRLFHAEQQTFLTLDTVPKTNKDAVFLRLTNRPSAAD ATSSRALWEIQVVQFDSYRGAAASWLREFRFKHLATDMYLSVERMRLNKTENTPTNTVSSLPEAEYCDDGQYYLVPKHSE KPETDESLLFVLDPCTFTKMDARISQRTYVRLWHVCTNTWIHTTDPTEKQNLYHFSSNEKGWVKVVSENFKIDKETFALL PVRPDEVRDLDFANDACKALNGFVKLIRSGMIISKEPMNVTIQLLTECIFFVTNQSNHVTDPIKIVDFKPPRDRQKLLRE QGVLDQVFALLRAPFLPRNGIDPEPLLCSPRKLSEKGNEIFKQIFHLCYSLLRYSQVGYRKNQEYLAEKFGQIQEQIGFD LLAEDTMTAVLHNNPKLLEKYVKNPHVERFVELVRNNKDGRFLVYLADLCVCRGEANKKIQELICNCVLNEVNRDIFIRT IIYDKSSNEVWICWSNSYCKQLVSVAMDAAKGQTEDIEVLDYYKHQLDLLAQMCHDQQYLAIDPPPERRLLNLSLELPAD LVLRCISDTRLPQDLRASFARLMLHLHVIRGSPLNAVHHARLWREIPLNSTVSGNSSRCVNGYVDSGYVRSGGEVFDKVL KTVDVYLEELRKTTREGEPVLDPSLSKLKQNRLTFEIVTLARALAHFEFYSFADLLRLAQNLLAIADSSPKKPEDKMAFD KTGLFRHVTYSVIGANALQKGAKQYLQHMKTESACNENTLQVKESKQMVLQTKLIIVEILNFIMDIRRDYRITVALSWFK KHFPCDELGELLSKTDLSEHEASELYKEVFQNCEENLDFDGRNGQLLLRILLQMTISDFSKLTSTALIVMFRHFTQYQEF VEDLKQVQLLVSNDDVENYQQIDRDLFILKILTEKSELWVQADKTRPESSSKLSFEEHGSSLDDSSKLLLSIRATSQQLE DSGLNATCAFHNNESFLSLVEKIEQHYYFARDECIKLLCKLLLGDDRTEAASALYELFDRAPLVCYPLVRQILYRVKQLC YKNDKPNKMNQQLLRNMRVHEYVLGFLSVPYDEKNDAEMPKLVTLSHEFLRSFCRNNIENQFRLYKHVSIEQDAKEGCLR VDTMEEVATLTAIFKNNRILCQNVSEEVIAHIVNMIEHKARSSVYIEFLQTVVMVQAKEIKSAQEKVAQEICSSSDDVRV YYADSASFEQLKQLMHNTGPEDLTSDHPLRYHIDLVRLLALCTRGRNSTTELKCASQLSMDHIVRVLTIPYCLIQVKDAY LQFMLHCYIDADAEMKDVDNVDFIERIMKNIFSDIQMYIASLSQMKMEKLTLLPNSAFEKYVCYTATEVLVKLFERPSAY QLIVEISQQHQFFSRMIQSLCRLQEELVRKCFTKNWYRVAECVRRLSRRAEENGVILSINGYMQPGYTEATVKQRWQSAF NSARFINQTNKCAKTRLHVPRYVQVAESFSSVVSCYQAMVNEFKVFALPLQTAETSVLVDVLHAPERLFISGSDLYQKCE NGVVIAKLIQHCKSLLQHGQEALCVRVLQTLCQMASNTKYNFINQAREVRINLLKQYFGDDAKRNTCRQTTKLESNGYAF GNDLKPIKELSLYDVQCKLNSAGASDLVIDLIMEEPSYEVFLMTVQLSKALLYEGNYEVQMSFYNRLKEKDTSEPFFNAL KTKLQVAQNKLRSDMMVCNDSRQRHSISNSISGRSSLINSPLPEDSAYIPNELKSIDVNSIELAVSLSTIPDGCLLGLFD PDINLNFWDDKKTVLPQEVALIEPVLRFLQLLCENHNLVLQNFLRYQGSRQNYNLVDETLMFLDVICGSTKGCLGVFGEI DEHNFSLITQTLVTLTEFCQGPCYENQNTVGNHESGLNMIISLVLNEIKPLCLTHMDLALEIKSAASKLLLAVMESRCDA DNAERVLINMDHMASGAKQLVQAIKMAYEMSEMKEFAVPKIRKNFETNYSSKKSKSRIGRPDIAIQDNIVISYPSTHVTL VDPQEVGHNIFILATQLARYNGTLREALDPENNKDSMTSKALRYYKQYTAQIEIVRSDRKMERVIFPIHAICEYLTPESK LNILLETEQDAQGSKVTEFFSQWPELFEEMKWQKKLQDRKYFSNCTKRLILWTRISFFFAILINIIIAIFYPFSGSNRQE LISPSNPFLYIFPTVSLLFLRMQWSEKALLGRTNEIYWAFAAIMSSFTILFITVIGVVLTLRVVGLLQLINKGVHIVSYI GNRGLIDKTWPERLQDNGIWYHLAYLLICIQGLIVHPLFYALLLFDIVASEETLRNVIRSVTRNWRSVIMTGLLAVILVY LFSIIGYLYFQKDFQLEVDRLDDNENDNIAYENFPSMQCIRPSSFIFRHYINENKCLAENLATNQPIDDKEELKVWSCQT LRMCILTTLNWGLRNGGGIGDVLRNVAPNEESFLSRIVYDLTFFIVIIIIVLNLVFGVIIDTFGDLRAERNEKVNQLRNN CFICGLGRERFDNKIITFEEHRKNEHNLYHYLYFIVWLQIKDETEFTGPESYVANCIKDHRSDWFPRMQAMSLAEDNQEA EQKDDINEIFDSLNRLLNTVEEQGRQLEELKQLLYKQNALQLVTPLLLNK
view sequence (2850 aa)
>Bma-ITR-1
MLRNQHRLYNNKLSIAMSLDTFHNTSLHIGDVISLYAEDYSRPVEDRLEERLFPRTGFLSTLGLVDDRCIVEIGNGTPDS
PPKKFRDCLFRVCPINRYAAQKQFWTEQKKFQVGESLFEEDMLKKLKHAADKEKEQNDMEYKKMLGANVQYGGTIQLLHV
KSDKYLTVLKNSPAKLERNAMKVYLDKNGHEGSWFYVEPVYKHSFFGDNVNGGDRISLVPYSYCPIPNTTGHVKPQLHLS
HLSLPDHPIGFEVNCSNELTEWQVLMFLQFDENQENIVKSGDVVRLFHAEQQTFLTLDTVPKTNKDAVFLRLTNRPSAAD
ATSSRALWEIQVVQFDSYRGAAASWLREFRFKHLATDMYLSVERMRLNKTENTPTNTVSSLPEAEYCDDGQYYLVPKHSE
KPETDESLLFVLDPCTFTKMDARISQRTYVRLWHVCTNTWIHTTDPTEKQNLYHFSSNEKGWVKVVSENFKIDKETFALL
PVRPDEVRDLDFANDACKALNGFVKLIRSGMIISKEPMNVTIQLLTECIFFVTNQSNHVTDPIKIVDFKPPRDRQKLLRE
QGVLDQVFALLRAPFLPRNGIDPEPLLCSPRKLSEKGNEIFKQIFHLCYSLLRYSQVGYRKNQEYLAEKFGQIQEQIGFD
LLAEDTMTAVLHNNPKLLEKYVKNPHVERFVELVRNNKDGRFLVYLADLCVCRGEANKKIQELICNCVLNEVNRDIFIRT
IIYDKSSNEVWICWSNSYCKQLVSVAMDAAKGQTEDIEVLDYYKHQLDLLAQMCHDQQYLAIDPPPERRLLNLSLELPAD
LVLRCISDTRLPQDLRASFARLMLHLHVIRGSPLNAVHHARLWREIPLNSTVSGNSSRCVNGYVDSGYVRSGGEVFDKVL
KTVDVYLEELRKTTREGEPVLDPSLSKLKQNRLTFEIVTLARALAHFEFYSFADLLRLAQNLLAIADSSPKKPEDKMAFD
KTGLFRHVTYSVIGANALQKGAKQYLQHMKTESACNENTLQVKESKQMVLQTKLIIVEILNFIMDIRRDYRITVALSWFK
KHFPCDELGELLSKTDLSEHEASELYKEVFQNCEENLDFDGRNGQLLLRILLQMTISDFSKLTSTALIVMFRHFTQYQEF
VEDLKQVQLLVSNDDVENYQQIDRDLFILKILTEKSELWVQADKTRPESSSKLSFEEHGSSLDDSSKLLLSIRATSQQLE
DSGLNATCAFHNNESFLSLVEKIEQHYYFARDECIKLLCKLLLGDDRTEAASALYELFDRAPLVCYPLVRQILYRVKQLC
YKNDKPNKMNQQLLRNMRVHEYVLGFLSVPYDEKNDAEMPKLVTLSHEFLRSFCRNNIENQFRLYKHVSIEQDAKEGCLR
VDTMEEVATLTAIFKNNRILCQNVSEEVIAHIVNMIEHKARSSVYIEFLQTVVMVQAKEIKSAQEKVAQEICSSSDDVRV
YYADSASFEQLKQLMHNTGPEDLTSDHPLRYHIDLVRLLALCTRGRNSTTELKCASQLSMDHIVRVLTIPYCLIQVKDAY
LQFMLHCYIDADAEMKDVDNVDFIERIMKNIFSDIQMYIASLSQMKMEKLTLLPNSAFEKYVCYTATEVLVKLFERPSAY
QLIVEISQQHQFFSRMIQSLCRLQEELVRKCFTKNWYRVAECVRRLSRRAEENGVILSINGYMQPGYTEATVKQRWQSAF
NSARFINQTNKCAKTRLHVPRYVQVAESFSSVVSCYQAMVNEFKVFALPLQTAETSVLVDVLHAPERLFISGSDLYQKCE
NGVVIAKLIQHCKSLLQHGQEALCVRVLQTLCQMASNTKYNFINQAREVRINLLKQYFGDDAKRNTCRQTTKLESNGYAF
GNDLKPIKELSLYDVQCKLNSAGASDLVIDLIMEEPSYEVFLMTVQLSKALLYEGNYEVQMSFYNRLKEKDTSEPFFNAL
KTKLQVAQNKLRSDMMVCNDSRQRHSISNSISGRSSLINSPLPEDSAYIPNELKSIDVNSIELAVSLSTIPDGCLLGLFD
PDINLNFWDDKKTVLPQEVALIEPVLRFLQLLCENHNLVLQNFLRYQGSRQNYNLVDETLMFLDVICGSTKGCLGVFGEI
DEHNFSLITQTLVTLTEFCQGPCYENQNTVGNHESGLNMIISLVLNEIKPLCLTHMDLALEIKSAASKLLLAVMESRCDA
DNAERVLINMDHMASGAKQLVQAIKMAYEMSEMKEFAVPKIRKNFETNYSSKKSKSRIGRPDIAIQDNIVISYPSTHVTL
VDPQEVGHNIFILATQLARYNGTLREALDPENNKDSMTSKALRYYKQYTAQIEIVRSDRKMERVIFPIHAICEYLTPESK
LNILLETEQDAQGSKVTEFFSQWPELFEEMKWQKKLQDRKYFSNCTKRLILWTRISFFFAILINIIIAIFYPFSGSNRQE
LISPSNPFLYIFPTVSLLFLRMQWSEKALLGRTNEIYWAFAAIMSSFTILFITVIGVVLTLRVVGLLQLINKGVHIVSYI
GNRGLIDKTWPERLQDNGIWYHLAYLLICIQGLIVHPLFYALLLFDIVASEETLRNVIRSVTRNWRSVIMTGLLAVILVY
LFSIIGYLYFQKDFQLEVDRLDDNENDNIAYENFPSMQCIRPSSFIFRHYINENKCLAENLATNQPIDDKEELKVWSCQT
LRMCILTTLNWGLRNGGGIGDVLRNVAPNEESFLSRIVYDLTFFIVIIIIVLNLVFGVIIDTFGDLRAERNEKVNQLRNN
CFICGLGRERFDNKIITFEEHRKNEHNLYHYLYFIVWLQIKDETEFTGPESYVANCIKDHRSDWFPRMQAMSLAEDNQEA
EQKDDINEIFDSLNRLLNTVEEQGRQLEELKQLLYKQNALQLVTPLLLNK
Estimated Isoelectric Point:
6.08040618896484
Estimated Molecular Weight:
328.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr134
Lys170
Gln145
Leu343
Gly100
Met64
Ser192
Tyr105
His68
Glu205
Arg155
Cys68
Phe137
Pro95
Val192
Asn167
Ala150
Ile176
Trp28
Asp156