Sequence:
download
BM37139sequence.fasta
>Bma-MTM-6, isoform a MSLPMVSSPTDEFEIARLLLIDGFKRLYETIMGHESLRDDDLILYCGLLQTVNKVQLIDRLGSEPNIVGSIHVTTSHVIF KAEDSAKEIWVPNGLIGTVEKGMLSVLGTPLTVKCKHFLTLTFLITRDKECQDLVETLNKCGKPVNITDVFAFENKERND DIRLNAEKRGWDRFDWAVEFARQGIGTADDRKWKITDFNTGYKYCDTYPECLCVPSATTTQTLIGSCKFRSRARLPVLTY FHRPNAASISRCAQPLTGFSARCVEDEMLMDAIAKTNPSSSTLYLIDTRPKMNAMVNKMQGKGFENVRNYTNLRFHFFDI DNIHIMRSSLSKLLEACHRSKTVSDYYKQLEASSWLKHVLALLECGNFLAISIARGISCVVHCSDGWDRTAQSVSIAQIL LDPFFRTIKGFQILIEKDWLGFGHKFDDRCGHIGAFNDEAAREVSPIFTQFLDATFQIMRQYPCAFEFNERYLIHMHEHA YSCQFGTFLGNCDKDRKDLNLAKRTQSLWAFLDDRHDDYINPLYEMNKYGFLGKINLHPSALVIWTAMYNRFDTGLLPRE NTNDVALSTMEHVGILEAHLASLQSRLAELKLLVGKQTPGSEVMSDSGHSSSISNTITPEASKIPERISDVTSLTHNYTM DEKWKKNSWDGGQNIQESGIYDALFPYSDNNSPLPALRWQSIRSADECSNIDCSAEFVTRGERRLHCYRCGKIHCRRCMM LTSDGVERVCIACSELVQQNNS
view sequence (742 aa)
>Bma-MTM-6, isoform a
MSLPMVSSPTDEFEIARLLLIDGFKRLYETIMGHESLRDDDLILYCGLLQTVNKVQLIDRLGSEPNIVGSIHVTTSHVIF
KAEDSAKEIWVPNGLIGTVEKGMLSVLGTPLTVKCKHFLTLTFLITRDKECQDLVETLNKCGKPVNITDVFAFENKERND
DIRLNAEKRGWDRFDWAVEFARQGIGTADDRKWKITDFNTGYKYCDTYPECLCVPSATTTQTLIGSCKFRSRARLPVLTY
FHRPNAASISRCAQPLTGFSARCVEDEMLMDAIAKTNPSSSTLYLIDTRPKMNAMVNKMQGKGFENVRNYTNLRFHFFDI
DNIHIMRSSLSKLLEACHRSKTVSDYYKQLEASSWLKHVLALLECGNFLAISIARGISCVVHCSDGWDRTAQSVSIAQIL
LDPFFRTIKGFQILIEKDWLGFGHKFDDRCGHIGAFNDEAAREVSPIFTQFLDATFQIMRQYPCAFEFNERYLIHMHEHA
YSCQFGTFLGNCDKDRKDLNLAKRTQSLWAFLDDRHDDYINPLYEMNKYGFLGKINLHPSALVIWTAMYNRFDTGLLPRE
NTNDVALSTMEHVGILEAHLASLQSRLAELKLLVGKQTPGSEVMSDSGHSSSISNTITPEASKIPERISDVTSLTHNYTM
DEKWKKNSWDGGQNIQESGIYDALFPYSDNNSPLPALRWQSIRSADECSNIDCSAEFVTRGERRLHCYRCGKIHCRRCMM
LTSDGVERVCIACSELVQQNNS
Estimated Isoelectric Point:
6.30577850341797
Estimated Molecular Weight:
84.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys39
Gln23
Leu72
Gly41
Met19
Ser58
Tyr21
His23
Glu42
Arg45
Cys26
Phe36
Pro25
Val35
Asn37
Ala44
Ile48
Trp12
Asp50