Sequence:
download
BM34386sequence.fasta
>Bma-LIN-42 MLHQHQSAQQPSANQSALQSSKLVRRKRLQHYIRQIKRLIAERIPPVGPEKKLGTIDVLDKAIELLRTTPLYAEITNPGL SPPHSWPDSPLDSITHISDDTWAPNVDFTRRHIFSANINLPDGRITDFQKVTSKEISNIDDGLHCGSSFLDLLAVYGRQA LLAGAYNGSIEKKKILTRLIGGNGAFELLCEYKRSDHGSIVSTHIHALELESAFGPSKTLSTFVFSTRHTSSCSLTYLDS LAANYIGYLPGEVINHSILHLLHPYDMAQIKQIHATLSTQRNEIVRQRRLRWIAFNGSIIHTNSEWFALWNPWTHKVDSV IGRHTLNEQPIGNADVLAEPCAPRIITPLDELTIRNIESEITAILNKEPRIVTKDERYKVAPIAHQKNSNSVDLKSSSTH LGTYIDNLIESFVVNAGNSGNKNLTPVVVDTCRSPINPTDLSATNSCNAIPLTYNQINCLENVHRLLKSQHHGGDIAVTS TIESTPENVSSPKLPPSEDSKSPLPIPEQEDDNRVTTDTVAPAMPLTRELLQQHTRKWEQEYRDTWKKRLNLKRPIQQTE FVVPVSSKIFRESNHRSAITLSAPATLPLSRSDCWPTMNKDDYYRSLGPNPPPPPGKNFQITSVPLPPPLPIEERRSAFV PLPSTTFSNTSKLPRDISQPINLSLTGSVQQAHSAVGITTVTSGSVERHFPTQQPQQQQYRSVIKTALASAPQHQRQYHE SNRLVLPSLAGTGITTQRYSSTGNMMDTTLEWYPTTEYSNGIPEEIGETCAARLINMAQRAQQQLDQKRFHSPLTTSPVK EATDALMLLQETTSF
view sequence (815 aa)
>Bma-LIN-42
MLHQHQSAQQPSANQSALQSSKLVRRKRLQHYIRQIKRLIAERIPPVGPEKKLGTIDVLDKAIELLRTTPLYAEITNPGL
SPPHSWPDSPLDSITHISDDTWAPNVDFTRRHIFSANINLPDGRITDFQKVTSKEISNIDDGLHCGSSFLDLLAVYGRQA
LLAGAYNGSIEKKKILTRLIGGNGAFELLCEYKRSDHGSIVSTHIHALELESAFGPSKTLSTFVFSTRHTSSCSLTYLDS
LAANYIGYLPGEVINHSILHLLHPYDMAQIKQIHATLSTQRNEIVRQRRLRWIAFNGSIIHTNSEWFALWNPWTHKVDSV
IGRHTLNEQPIGNADVLAEPCAPRIITPLDELTIRNIESEITAILNKEPRIVTKDERYKVAPIAHQKNSNSVDLKSSSTH
LGTYIDNLIESFVVNAGNSGNKNLTPVVVDTCRSPINPTDLSATNSCNAIPLTYNQINCLENVHRLLKSQHHGGDIAVTS
TIESTPENVSSPKLPPSEDSKSPLPIPEQEDDNRVTTDTVAPAMPLTRELLQQHTRKWEQEYRDTWKKRLNLKRPIQQTE
FVVPVSSKIFRESNHRSAITLSAPATLPLSRSDCWPTMNKDDYYRSLGPNPPPPPGKNFQITSVPLPPPLPIEERRSAFV
PLPSTTFSNTSKLPRDISQPINLSLTGSVQQAHSAVGITTVTSGSVERHFPTQQPQQQQYRSVIKTALASAPQHQRQYHE
SNRLVLPSLAGTGITTQRYSSTGNMMDTTLEWYPTTEYSNGIPEEIGETCAARLINMAQRAQQQLDQKRFHSPLTTSPVK
EATDALMLLQETTSF
Estimated Isoelectric Point:
8.22998809814453
Estimated Molecular Weight:
90.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr69
Lys35
Gln44
Leu78
Gly34
Met8
Ser80
Tyr20
His30
Glu43
Arg47
Cys9
Phe19
Pro63
Val38
Asn44
Ala49
Ile59
Trp10
Asp36