Sequence:
download
BM29613sequence.fasta
>Bma-UNC-22 MPGAPRFTQKPSIQQTPQGDLLMECYLEAEPPPDIVWNHAGTPIIAGPRVELTLTNLQTNLYKAILIIKEPNVGDGGAYK CTASNQFGESNANINLNFAGAGDEQKGAAKGPTFLSKPRIIPKDGGALIVMECRVKSTSKPYGIWYKNGVPIHENTLYSI SFSDLGESSYLLQLELHNPAAEDAGQYKCNIKNDLGETNANLTLNFEQEPMEQHEKIDKNREKDPASPRPASRQGSRLGS SKKQMKSREGTPKKSLKSREGTPRKSIQSETATPTQEAETNVSSITEMSEVKTEQMEVDNVSAKRKSMTTLPQKEKKSRQ KSPRPKSKSPKPETFQVDNENTNKDRMMSCTSSNKADHTSAAKASEVRKIPKDSSIKVDEIGAQECRNETPKSTTITKTE ETKINQITKHSLGAKEKNLELESNLISESELEKSTASIARNEKKHPTKSREAIKKKKKEEQKSKSSKLRDLKSELEGKET DEISGSGLMIGPERKKELMAMHLDGGASGDEISESISELPSVSEITYKRPSAISEGGIRKSVSGKMSRRRSSVDMRRENL AAEMLDKPSTPLKNIGPEGAPRILEIPENVTVTKNDTAVLKCKVEGNPAPTFKWSKGLVEIPSGGRCRIVTDQQDNSVNL VMQKCRSNDDGPYTLTIENKYGKDSASVKLLVISEAGLDFRSMLKHREHEEGGDEDDEKSTSSRTRSMTDVERRQSLFPG KKVEKWEEPLENKTVQQQVDKICELKCTYSRSNAKIRWYKNKKEIFSGGLKYKIVTEKAVCTLIINNPEVDDSGKYTCEA NGLPTTAVLTVDEPPMKYSFITPLPNTQEIYRTKQGVLTCKVNNKRAPLVWHHNGKPISDSDKRFLIENDAIGRFTLTIK EVTNGDAGEWMAKITNEIYSKVEVYVEEPRHTFVIPLKSQKVTENESVQLVCDLNDKDADVEWWHDGVQIKIDGQKFVAE AENRKRRLIINSAKLEDHGEYKCTTKDDQTLAQLIVDALNKFVVPLSDIEVFEKEDVDLRCETKDNKTPGVWSKNGKIIT SMPGGKFETISRQGVHTLKISKIEISEGDIYEINVGGLEGSCVITVLEAEKKPVMNWKSKKVEMECDKPETIKIPFSVKG GRKGNPKPKLCRDGEPVDLEKMKDLIEVVINDDVVEIKFKNPKKEDAGKWTLELSNSGGTALAPFEVMIKDKPKPPKGPL ETKNVTAKGCDLIWNAPDTDDSSPVQGYVVEMQEGDGKWTKIGETKQTEFKVKSLKEHGQYKFRVKAVNDIGQSEPLISE IITAKNPYSVPDKPKNMTATDISKNSLSLQWEAPDNDGGSPVEKYVIERRDKSGKNWTEVGTVQSSEGKSVFTVIDDTVI EGNEYYYRVYAVNQAGSGDPCDHGRAFKILAKPEPPAFPNGGIYDLILKVGETIKYDLIIVGEPMPEAFWTVNDKVIKNG GRCKIITERGKHLLKIEDAARADSGKYTLTLKNESGKCDSTATVTVVGPPDQPKGPLVISAICGDGATLAWKPPDDNGGE PLEEYIVEAQDMDEKGKFVVVGSMPASETQMVVHGLKDKGNYKFRVKAKNKEGESSPLTADQYVQIKDPWDEPGKPGCPE IIDYDADKIDIAWQPPIEDGGAPIEEYIIEMKDPVTQKWTEAARSPKANATITGLKEGNEYQFRVKAVNKAGPGQPSKPS ERQVAKPKFVPAWLKMDNLKSLIVKAGQSVKWDVEIGGEPTPEVKWIKSDEVLTPNESVQIEMKRHGHTLLYILSAKRSD GGKYTLSVRNSTGEQSGTAELTVLDKPNPPEGPLKISEVFENKCKLNWKPPEDDGGEPIAYYEIEKFDEEVGKWIRCTKV KDTEAYIDDLQKGHTYQFRVKAVNHEGASDPLSTKDSILAKNPYDEPGKPTTPEAIDWDINRVNLAWKPPDDDGGDPISG YVVEKRKKHAKDWVECARTNGAGCEANILGLKEGEEYQFRVRAINKAGMGKPSDPSRKVIAKPRNLKPHIHRESMKSIVI KVGQSVEFDVPVSGEPPPEKAWMLNDKTIEDDEHITITDEDYRTAYVLKNAMRKHSGKYTLTVFNINGTDKHSVDVTVIG KPSAPEGPLEVSDIHADHMNLEWKPPDDDGGLPIDHYEIEKMDVSTGRWVPCGRSEDCKATVKNLQESKTYQFRVRAVNK EGQSDPLATIGDGFLTKNPYDVPEKVDKPELVNWDKDYVDLQWKAPDDGGTPIEAYSLEIKDKHGKWTEVMRISGLETSA RVENLKEGEEYQFRIIAKNKAGYGEPSNPSDHIIAKPRHLAPYIHRQDVEDIIVKVGQPLRLIIHIDGEPPPKIIWSCDG EPLDSNIVVENEDYITKFTVTKAIRKQSGFYTIMAVNESGSDSVKFEIKIKGKPGKPKGPVEVTNIFDDRTTLNWQPPEN DGGEPIDHYELEKMDTKDGIWVPCGKSKNTSFEVKNLIKDKFYQFRVKAVNSEGSSEPLETDSSIHTKNPFDKPDKPGKP VPTDWDKDHIDLEWTKPANDGGAPIEEYLIEKRNKYGRWEPALTVSGQSTAAAVPNLAEGEEYEFRIIAINKGGPSEPSD PSAAVIAKTQNLAPKIDRSTLKPMKVKAGQMVVFDVSVEGEPPPTITWINANGHEMRHGGRIKLDNPEYRTKLQIRASER SDSGIYKIHAVNPNGEDEATVEINVIDKPRPPDGPLNVTDIHADHATLDWKAPTDDGGLPIDSYVVERFDTSTGHWIPCV KVDDGQTSAVIDGLIEGHEYKFRVSAVNAEGASDPLDTFGAIRAKNPYDAPGKTGKPEVIDWDNDHIDLKWTSPTNDGGA PIEGYVIEMKEKFAPFWKEVKEVSADQLTTTIPNLKDGSEYEFRIRAKNKAGFGDPSDPSDSIIAKPRHLPPKIDRTAIE EIRVRAGLNFQLNIPVSGEPPPTVMWMFSGQPLVSSERIKIENPDYRTKFVVKRALRSDTGIYIIKAENKNGTDTAEVKV FVYDRPGEPKGPLKTDNVHKNGCTLVWKEPDDDGGIEINHYIIEKQDVKSGRWTFAGEAATTTMKIDDLTPGHEYKFRVK AVNKYGESDPLEITQPIIAKDPFDTAGKPGTPEIIDWDKEHVDLRWNPPLDDGGAAIEKYVIEKKMANGDWEYAEEVPAD QTTTTINHLKEGATYQFRVKAINKAGESTPSDPSCTFVAKARNLPPKIDRSNLNEIRIKTGRTIEFDVKVEGEPPPKISW FNNETPLTTFERTKVDNSVDYRTKLVTVNAVRNDSGMYKIIAVNENGKDEEEVKVVVLDIPGTPNGPLKITDITKESCIM NWNPPEDDGGSPILHYLVEKQEANGRWVPCGETSNTSLRVSKLVEGKEYKFRVKAINRQGESQPLTSTYPIIAKNPFDEP GKPTNFTAVDWGKDYIDLEWKAPLDDGGAPIENYIVEKKDKLGDWMPCVTVAGNMTKATVANLIPGETYQFRVRAVNKGG KGEPSDPTREIIAKPRKLTPKINLAGLFDIRVRAGSPVHLEVSYEGEPAPEAYWKINDAVFTGTDRVEIITKDGNSKIVI PSSVRGDTGTYTIQVENEHGKDKASCTVTVLDVPGVPEGPAKISDITKEGCTLTWRPPTDDGGSEITHYVVEKMDMTRGT WQEVGHFPDCTAKVTKLIDGKEYKFCIKAVNMQGQSNSLETQEIIARNQFDVPQSASKPEITDWDKDRIDVVWKPPTDTG GLPIQEYIIEKKEKGNPVWIEAGRVSGDVTAFSTNGLKPGSEYEFRIIAVNEIGPSDPSEPSDAQKARPRYVIPKIISQI RKFKVKAGLSLTVEAEYIGSPDPSVSWEFKDEPLAENLLVSSKNGVLTSTTSFFIPSAKRSENGNYTLRLKNEAGETSGL FEVIVQDRPSTPQGPIEVTNVTKESCILNWQPPQDDGGAEITNYVVEKRDLQSNIWIPVSVFVPGTTAVVSKLAEGHQYE FRVMAENANGRSDPLNSDSPVLAKDPFGNPGKPGRPVVTNHDLNHIDIEWEPPKDNGGNQISHYNIERKDLKNGRWIKIN NEPVKDISFVDDRVQEGHTYEYRVRAVNQAGHGAPSDPSAAATAKPMYEAPVFDIDIQGKEFRVRAGEPLDINIPYTASP KPDIIWVKNDQTLNGVETDDSKTRLYIKKSKRSDSGECIITASNSYGNVEATIKISVVDRPGPPEGPMAYPETSRHSLTL RWRPPEDDGGSEITGYRIEYQETDMLNWIRVIEAVGGTTYIVRGLDHGKQYRFRVRAENVMGLSEPLVGAPVFAKDPFDQ PGPPSTPEITGYSRNQINLSWNPPSNDGGSPIIGYVIEKFEKGDNDWTPVKMRSTKNTKAIVTGLIEGETYQFRVRAVNL AGEGEPSGNSEPTMCRPFVTPPDAPDQPRVGKLTKNFAELTWNRPLKDGGAPIEGYIVEKRKICVGDWIPYNDKPVKDTF LVVEPLEENGEYEFRVKAVNSVGKSKPSRPTDVVRIEEQPGRPCLDLSDIKDITVKAGDNFEIKIPFTGGNPKPLATIFN GVKEIFGEDDHINIEVSDGFVTLTTKSARRSDAGPYRVTLSNRFGKDSTKVNVNVLSPPGKPVGPIAASEIVGDAITLHW SPPLDDGGAGVSNYVVEKRESDGTWTKVGQPAGTSFRVRNLENGHPYEFRVSAENHYGIGEPLETTEPITAKDPFSNPDA PGRPEAIATTENTITLHWTQPLKNGGSPIQGYVLEKRKIGDDWSRCAFGLINDTQYRVTGLTPHKRYEFRIAAVNGVGQS PWSQNSEQITAQMEAVRPRIQLALFGKDIIAHVGSSAKILVPFSSSPSPEIIWNKDGKPIDEMSKRLRLESNDFLTQLLY EKCERDDTATYTIKLENDAGSDSVNVRLLVVDSPSPPKSFIVSDITPDSCVLDWEPPDDDGGSHITNYILEKCCVNTPSD DVWEKISSFVRGTNYVVTGLNEGESYKFRVRAENQYGISGPNAVNEPIVACYQFKVPSQPDPPTVRDIDSTWAEVEWESP LDGGSRILGYVLQYKEPTFGKWINASARPLEATSFRVQNLKDKGEYEFRVIAKNKAGLSKPSLPSEKVQLKLKFGPPGPP TQISVEAIGRNHVTLTWAPPTDDGGSKITGYIVESREVGIQSWRVVSDYNVQQHEFTVPNLIEFHDYEFRITAINKYGKG LPSLPSSPIKIQEMGGSKPVIVVKPANTASPYNRRAVFTCEAIGRPAPTARWLRNGREIPEGARYRTEAQDEVFKLIIKE VWDIDSGEYTCEVSNIYGSDSATAALLVQAPPVIEKGVANAIYADGELVRLKIYFSGTGPFNYTFTLNKKEIPADHPNIH FVDFDNHVIITIPSIHSSEAGRYELTISNDSGEANTGFWLNVTGLPSAPQGPLQFSGLNLSQVLLSWKPPVSDGGARISN YVVEKRNLTKDEWTEVATLIKDTNYLVSDLFEGHEYEFRVSAVNENGQGPPLVGDQSIIARLPFDPPSSPGKPQSVNIGE NSMTLSWARPNFDGGGRIRGYLIEKREAGTDIWQKCNYNTNPSTSCVVNNLIENRDYEFRVFAVNDAGHSEPSVSDIVKY VHLSSGQAPTIVTPLTDLYGEQGRSVTLECVITGNPQPEYRWYRGLRELIETSKYSIYDKGDTQTLVINDLHADDTDEYS CRATNSNGTKSTQAQMTVCSKPRVFLPPQYHGGYEAKKNESIELKVPFKAFPQPKAKWFKNAEPISGSDKYKIITDEKFT TLTISNGTREDFGQYRVVVENNVGSDSATISLTVADRPDPPRFPIVENVLDEAVILSWKTPALDENVLITNYIVERREAT SGQWEQCARSRYTYLTVEGLKPKHTYEFRIIAENKYGQSKPCEPTAPITIPEQRIRKKGYDVDDLGRIVHGKGVTSDNYD AYVIDVWKEYYPQPVEPKRESVYDYYDILEEIGSGAFGSVHRCVERATGNTFAAKFVNTPHDADKDTVRKEINTMSVLRH PKLINLHDAFEDDKEMVMVYEFMSGGELFEKISDERNRMSEMDAVGYIRQICEALCHMHEMSYVHLDLKPENIMFITKKS DQLKLIDFGLAAKLDPRDTVKVTTGTAEFAAPEVVANEPVGYYTDMWSVGVLAYILLSGLSPFGGETDDETLRNVKKCDW NMDDPSFASISQDAKDFIKKILMLDPKSRMTVHEALEHPWLNGATSNVPSQQIPNERYHSVRDSVRRKYDAWPEPNPPLG RISNYSSLKKHRPSEYHIHDTWFSREEGQPRFIVKPFSTSCDEGGNATFSCRVIASSPPIVTWHKEADELKQSTKYMKKY TDNNYMIVINRVRPEDAGEYTVRAKNSYGSKEEVAFLKVTESTRRQSNSIISEFEKRAYVMREPELFKERQSAPKFTFHL RSRLIQKNHPCKLICNVQGDPIPKVEWFKDDKPINMDRAHLTYRSGVCTMELFSSRMDDAGTYRCEATNSLGTDYTECSV NVQGRSGESIPVKPLRTRRIYDTLSAGNIERSQSSADVLPEHNIKPSTPQSRDDLTAKYNDKPPTFMSKLSNTAVNEGEQ AEFSCTITAYPEPLIEWLHNGERIIGDSRLKISFVTGRASLTIRNINKQDAGEYCCKASNSAGSETSKAELIIKKSATGM DDAVGEPLKNGELTAKETAKQPETANQTILNGDVMNNMGGKTLEKDGQFRIIRHLEGIQVASGSTAIFSVLSSGAVDEVI WLKNGKEIQSNENVTMKVSDSEYRLELSKVSPDDHGIYQIDFRHGGKTFTSAASLVVLDKQNERAVCKLPQSVTVKSSTP CKLVLEMENGEDWTVQWFKGLSKVEKSNRIKSVKSGNAFKLDFKDVQPDDEGIYVVKVIKDKKAICKYAAALLVEK
view sequence (6796 aa)
>Bma-UNC-22
MPGAPRFTQKPSIQQTPQGDLLMECYLEAEPPPDIVWNHAGTPIIAGPRVELTLTNLQTNLYKAILIIKEPNVGDGGAYK
CTASNQFGESNANINLNFAGAGDEQKGAAKGPTFLSKPRIIPKDGGALIVMECRVKSTSKPYGIWYKNGVPIHENTLYSI
SFSDLGESSYLLQLELHNPAAEDAGQYKCNIKNDLGETNANLTLNFEQEPMEQHEKIDKNREKDPASPRPASRQGSRLGS
SKKQMKSREGTPKKSLKSREGTPRKSIQSETATPTQEAETNVSSITEMSEVKTEQMEVDNVSAKRKSMTTLPQKEKKSRQ
KSPRPKSKSPKPETFQVDNENTNKDRMMSCTSSNKADHTSAAKASEVRKIPKDSSIKVDEIGAQECRNETPKSTTITKTE
ETKINQITKHSLGAKEKNLELESNLISESELEKSTASIARNEKKHPTKSREAIKKKKKEEQKSKSSKLRDLKSELEGKET
DEISGSGLMIGPERKKELMAMHLDGGASGDEISESISELPSVSEITYKRPSAISEGGIRKSVSGKMSRRRSSVDMRRENL
AAEMLDKPSTPLKNIGPEGAPRILEIPENVTVTKNDTAVLKCKVEGNPAPTFKWSKGLVEIPSGGRCRIVTDQQDNSVNL
VMQKCRSNDDGPYTLTIENKYGKDSASVKLLVISEAGLDFRSMLKHREHEEGGDEDDEKSTSSRTRSMTDVERRQSLFPG
KKVEKWEEPLENKTVQQQVDKICELKCTYSRSNAKIRWYKNKKEIFSGGLKYKIVTEKAVCTLIINNPEVDDSGKYTCEA
NGLPTTAVLTVDEPPMKYSFITPLPNTQEIYRTKQGVLTCKVNNKRAPLVWHHNGKPISDSDKRFLIENDAIGRFTLTIK
EVTNGDAGEWMAKITNEIYSKVEVYVEEPRHTFVIPLKSQKVTENESVQLVCDLNDKDADVEWWHDGVQIKIDGQKFVAE
AENRKRRLIINSAKLEDHGEYKCTTKDDQTLAQLIVDALNKFVVPLSDIEVFEKEDVDLRCETKDNKTPGVWSKNGKIIT
SMPGGKFETISRQGVHTLKISKIEISEGDIYEINVGGLEGSCVITVLEAEKKPVMNWKSKKVEMECDKPETIKIPFSVKG
GRKGNPKPKLCRDGEPVDLEKMKDLIEVVINDDVVEIKFKNPKKEDAGKWTLELSNSGGTALAPFEVMIKDKPKPPKGPL
ETKNVTAKGCDLIWNAPDTDDSSPVQGYVVEMQEGDGKWTKIGETKQTEFKVKSLKEHGQYKFRVKAVNDIGQSEPLISE
IITAKNPYSVPDKPKNMTATDISKNSLSLQWEAPDNDGGSPVEKYVIERRDKSGKNWTEVGTVQSSEGKSVFTVIDDTVI
EGNEYYYRVYAVNQAGSGDPCDHGRAFKILAKPEPPAFPNGGIYDLILKVGETIKYDLIIVGEPMPEAFWTVNDKVIKNG
GRCKIITERGKHLLKIEDAARADSGKYTLTLKNESGKCDSTATVTVVGPPDQPKGPLVISAICGDGATLAWKPPDDNGGE
PLEEYIVEAQDMDEKGKFVVVGSMPASETQMVVHGLKDKGNYKFRVKAKNKEGESSPLTADQYVQIKDPWDEPGKPGCPE
IIDYDADKIDIAWQPPIEDGGAPIEEYIIEMKDPVTQKWTEAARSPKANATITGLKEGNEYQFRVKAVNKAGPGQPSKPS
ERQVAKPKFVPAWLKMDNLKSLIVKAGQSVKWDVEIGGEPTPEVKWIKSDEVLTPNESVQIEMKRHGHTLLYILSAKRSD
GGKYTLSVRNSTGEQSGTAELTVLDKPNPPEGPLKISEVFENKCKLNWKPPEDDGGEPIAYYEIEKFDEEVGKWIRCTKV
KDTEAYIDDLQKGHTYQFRVKAVNHEGASDPLSTKDSILAKNPYDEPGKPTTPEAIDWDINRVNLAWKPPDDDGGDPISG
YVVEKRKKHAKDWVECARTNGAGCEANILGLKEGEEYQFRVRAINKAGMGKPSDPSRKVIAKPRNLKPHIHRESMKSIVI
KVGQSVEFDVPVSGEPPPEKAWMLNDKTIEDDEHITITDEDYRTAYVLKNAMRKHSGKYTLTVFNINGTDKHSVDVTVIG
KPSAPEGPLEVSDIHADHMNLEWKPPDDDGGLPIDHYEIEKMDVSTGRWVPCGRSEDCKATVKNLQESKTYQFRVRAVNK
EGQSDPLATIGDGFLTKNPYDVPEKVDKPELVNWDKDYVDLQWKAPDDGGTPIEAYSLEIKDKHGKWTEVMRISGLETSA
RVENLKEGEEYQFRIIAKNKAGYGEPSNPSDHIIAKPRHLAPYIHRQDVEDIIVKVGQPLRLIIHIDGEPPPKIIWSCDG
EPLDSNIVVENEDYITKFTVTKAIRKQSGFYTIMAVNESGSDSVKFEIKIKGKPGKPKGPVEVTNIFDDRTTLNWQPPEN
DGGEPIDHYELEKMDTKDGIWVPCGKSKNTSFEVKNLIKDKFYQFRVKAVNSEGSSEPLETDSSIHTKNPFDKPDKPGKP
VPTDWDKDHIDLEWTKPANDGGAPIEEYLIEKRNKYGRWEPALTVSGQSTAAAVPNLAEGEEYEFRIIAINKGGPSEPSD
PSAAVIAKTQNLAPKIDRSTLKPMKVKAGQMVVFDVSVEGEPPPTITWINANGHEMRHGGRIKLDNPEYRTKLQIRASER
SDSGIYKIHAVNPNGEDEATVEINVIDKPRPPDGPLNVTDIHADHATLDWKAPTDDGGLPIDSYVVERFDTSTGHWIPCV
KVDDGQTSAVIDGLIEGHEYKFRVSAVNAEGASDPLDTFGAIRAKNPYDAPGKTGKPEVIDWDNDHIDLKWTSPTNDGGA
PIEGYVIEMKEKFAPFWKEVKEVSADQLTTTIPNLKDGSEYEFRIRAKNKAGFGDPSDPSDSIIAKPRHLPPKIDRTAIE
EIRVRAGLNFQLNIPVSGEPPPTVMWMFSGQPLVSSERIKIENPDYRTKFVVKRALRSDTGIYIIKAENKNGTDTAEVKV
FVYDRPGEPKGPLKTDNVHKNGCTLVWKEPDDDGGIEINHYIIEKQDVKSGRWTFAGEAATTTMKIDDLTPGHEYKFRVK
AVNKYGESDPLEITQPIIAKDPFDTAGKPGTPEIIDWDKEHVDLRWNPPLDDGGAAIEKYVIEKKMANGDWEYAEEVPAD
QTTTTINHLKEGATYQFRVKAINKAGESTPSDPSCTFVAKARNLPPKIDRSNLNEIRIKTGRTIEFDVKVEGEPPPKISW
FNNETPLTTFERTKVDNSVDYRTKLVTVNAVRNDSGMYKIIAVNENGKDEEEVKVVVLDIPGTPNGPLKITDITKESCIM
NWNPPEDDGGSPILHYLVEKQEANGRWVPCGETSNTSLRVSKLVEGKEYKFRVKAINRQGESQPLTSTYPIIAKNPFDEP
GKPTNFTAVDWGKDYIDLEWKAPLDDGGAPIENYIVEKKDKLGDWMPCVTVAGNMTKATVANLIPGETYQFRVRAVNKGG
KGEPSDPTREIIAKPRKLTPKINLAGLFDIRVRAGSPVHLEVSYEGEPAPEAYWKINDAVFTGTDRVEIITKDGNSKIVI
PSSVRGDTGTYTIQVENEHGKDKASCTVTVLDVPGVPEGPAKISDITKEGCTLTWRPPTDDGGSEITHYVVEKMDMTRGT
WQEVGHFPDCTAKVTKLIDGKEYKFCIKAVNMQGQSNSLETQEIIARNQFDVPQSASKPEITDWDKDRIDVVWKPPTDTG
GLPIQEYIIEKKEKGNPVWIEAGRVSGDVTAFSTNGLKPGSEYEFRIIAVNEIGPSDPSEPSDAQKARPRYVIPKIISQI
RKFKVKAGLSLTVEAEYIGSPDPSVSWEFKDEPLAENLLVSSKNGVLTSTTSFFIPSAKRSENGNYTLRLKNEAGETSGL
FEVIVQDRPSTPQGPIEVTNVTKESCILNWQPPQDDGGAEITNYVVEKRDLQSNIWIPVSVFVPGTTAVVSKLAEGHQYE
FRVMAENANGRSDPLNSDSPVLAKDPFGNPGKPGRPVVTNHDLNHIDIEWEPPKDNGGNQISHYNIERKDLKNGRWIKIN
NEPVKDISFVDDRVQEGHTYEYRVRAVNQAGHGAPSDPSAAATAKPMYEAPVFDIDIQGKEFRVRAGEPLDINIPYTASP
KPDIIWVKNDQTLNGVETDDSKTRLYIKKSKRSDSGECIITASNSYGNVEATIKISVVDRPGPPEGPMAYPETSRHSLTL
RWRPPEDDGGSEITGYRIEYQETDMLNWIRVIEAVGGTTYIVRGLDHGKQYRFRVRAENVMGLSEPLVGAPVFAKDPFDQ
PGPPSTPEITGYSRNQINLSWNPPSNDGGSPIIGYVIEKFEKGDNDWTPVKMRSTKNTKAIVTGLIEGETYQFRVRAVNL
AGEGEPSGNSEPTMCRPFVTPPDAPDQPRVGKLTKNFAELTWNRPLKDGGAPIEGYIVEKRKICVGDWIPYNDKPVKDTF
LVVEPLEENGEYEFRVKAVNSVGKSKPSRPTDVVRIEEQPGRPCLDLSDIKDITVKAGDNFEIKIPFTGGNPKPLATIFN
GVKEIFGEDDHINIEVSDGFVTLTTKSARRSDAGPYRVTLSNRFGKDSTKVNVNVLSPPGKPVGPIAASEIVGDAITLHW
SPPLDDGGAGVSNYVVEKRESDGTWTKVGQPAGTSFRVRNLENGHPYEFRVSAENHYGIGEPLETTEPITAKDPFSNPDA
PGRPEAIATTENTITLHWTQPLKNGGSPIQGYVLEKRKIGDDWSRCAFGLINDTQYRVTGLTPHKRYEFRIAAVNGVGQS
PWSQNSEQITAQMEAVRPRIQLALFGKDIIAHVGSSAKILVPFSSSPSPEIIWNKDGKPIDEMSKRLRLESNDFLTQLLY
EKCERDDTATYTIKLENDAGSDSVNVRLLVVDSPSPPKSFIVSDITPDSCVLDWEPPDDDGGSHITNYILEKCCVNTPSD
DVWEKISSFVRGTNYVVTGLNEGESYKFRVRAENQYGISGPNAVNEPIVACYQFKVPSQPDPPTVRDIDSTWAEVEWESP
LDGGSRILGYVLQYKEPTFGKWINASARPLEATSFRVQNLKDKGEYEFRVIAKNKAGLSKPSLPSEKVQLKLKFGPPGPP
TQISVEAIGRNHVTLTWAPPTDDGGSKITGYIVESREVGIQSWRVVSDYNVQQHEFTVPNLIEFHDYEFRITAINKYGKG
LPSLPSSPIKIQEMGGSKPVIVVKPANTASPYNRRAVFTCEAIGRPAPTARWLRNGREIPEGARYRTEAQDEVFKLIIKE
VWDIDSGEYTCEVSNIYGSDSATAALLVQAPPVIEKGVANAIYADGELVRLKIYFSGTGPFNYTFTLNKKEIPADHPNIH
FVDFDNHVIITIPSIHSSEAGRYELTISNDSGEANTGFWLNVTGLPSAPQGPLQFSGLNLSQVLLSWKPPVSDGGARISN
YVVEKRNLTKDEWTEVATLIKDTNYLVSDLFEGHEYEFRVSAVNENGQGPPLVGDQSIIARLPFDPPSSPGKPQSVNIGE
NSMTLSWARPNFDGGGRIRGYLIEKREAGTDIWQKCNYNTNPSTSCVVNNLIENRDYEFRVFAVNDAGHSEPSVSDIVKY
VHLSSGQAPTIVTPLTDLYGEQGRSVTLECVITGNPQPEYRWYRGLRELIETSKYSIYDKGDTQTLVINDLHADDTDEYS
CRATNSNGTKSTQAQMTVCSKPRVFLPPQYHGGYEAKKNESIELKVPFKAFPQPKAKWFKNAEPISGSDKYKIITDEKFT
TLTISNGTREDFGQYRVVVENNVGSDSATISLTVADRPDPPRFPIVENVLDEAVILSWKTPALDENVLITNYIVERREAT
SGQWEQCARSRYTYLTVEGLKPKHTYEFRIIAENKYGQSKPCEPTAPITIPEQRIRKKGYDVDDLGRIVHGKGVTSDNYD
AYVIDVWKEYYPQPVEPKRESVYDYYDILEEIGSGAFGSVHRCVERATGNTFAAKFVNTPHDADKDTVRKEINTMSVLRH
PKLINLHDAFEDDKEMVMVYEFMSGGELFEKISDERNRMSEMDAVGYIRQICEALCHMHEMSYVHLDLKPENIMFITKKS
DQLKLIDFGLAAKLDPRDTVKVTTGTAEFAAPEVVANEPVGYYTDMWSVGVLAYILLSGLSPFGGETDDETLRNVKKCDW
NMDDPSFASISQDAKDFIKKILMLDPKSRMTVHEALEHPWLNGATSNVPSQQIPNERYHSVRDSVRRKYDAWPEPNPPLG
RISNYSSLKKHRPSEYHIHDTWFSREEGQPRFIVKPFSTSCDEGGNATFSCRVIASSPPIVTWHKEADELKQSTKYMKKY
TDNNYMIVINRVRPEDAGEYTVRAKNSYGSKEEVAFLKVTESTRRQSNSIISEFEKRAYVMREPELFKERQSAPKFTFHL
RSRLIQKNHPCKLICNVQGDPIPKVEWFKDDKPINMDRAHLTYRSGVCTMELFSSRMDDAGTYRCEATNSLGTDYTECSV
NVQGRSGESIPVKPLRTRRIYDTLSAGNIERSQSSADVLPEHNIKPSTPQSRDDLTAKYNDKPPTFMSKLSNTAVNEGEQ
AEFSCTITAYPEPLIEWLHNGERIIGDSRLKISFVTGRASLTIRNINKQDAGEYCCKASNSAGSETSKAELIIKKSATGM
DDAVGEPLKNGELTAKETAKQPETANQTILNGDVMNNMGGKTLEKDGQFRIIRHLEGIQVASGSTAIFSVLSSGAVDEVI
WLKNGKEIQSNENVTMKVSDSEYRLELSKVSPDDHGIYQIDFRHGGKTFTSAASLVVLDKQNERAVCKLPQSVTVKSSTP
CKLVLEMENGEDWTVQWFKGLSKVEKSNRIKSVKSGNAFKLDFKDVQPDDEGIYVVKVIKDKKAICKYAAALLVEK
Estimated Isoelectric Point:
5.62763214111328
Estimated Molecular Weight:
756.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr428
Lys584
Gln187
Leu370
Gly491
Met96
Ser471
Tyr205
His112
Glu559
Arg306
Cys81
Phe182
Pro483
Val479
Asn348
Ala384
Ile462
Trp113
Asp455