Sequence:
download
BM25522sequence.fasta
>Bma-COL-47 MLFHDVNALYYEILDGMDEFKTIANDAWLEMMKYRAVKNKRNVDSTSKLTLSELFRSKRIYRQAYDNHIKRSQCACSSQP NNCPSGPQGPPGIPGTPGIDGQPGLPGKPGVNGTAILFDLELDEYTTCIECPAGPEGPPGEPGPMGEEGPPGIPGQPGPD GNPAMAGERGPIGEQGLPGPPGPIGPPGKMGESMLVMYGTPGPKGPPGPEGSIGPSGEDGEPGLEGDRGLAGEQGPPGTS GPPGQEGPPGEPGEPGTPGVDAAYCPCPQRTSYVYVESAEPSSKPHSFKEAEVYTPDEAELLPSDEYFHTLLQPDHTYVR YKNSRRNRHLLNKVTRKKTVSNRKSKKTS
view sequence (349 aa)
>Bma-COL-47
MLFHDVNALYYEILDGMDEFKTIANDAWLEMMKYRAVKNKRNVDSTSKLTLSELFRSKRIYRQAYDNHIKRSQCACSSQP
NNCPSGPQGPPGIPGTPGIDGQPGLPGKPGVNGTAILFDLELDEYTTCIECPAGPEGPPGEPGPMGEEGPPGIPGQPGPD
GNPAMAGERGPIGEQGLPGPPGPIGPPGKMGESMLVMYGTPGPKGPPGPEGSIGPSGEDGEPGLEGDRGLAGEQGPPGTS
GPPGQEGPPGEPGEPGTPGVDAAYCPCPQRTSYVYVESAEPSSKPHSFKEAEVYTPDEAELLPSDEYFHTLLQPDHTYVR
YKNSRRNRHLLNKVTRKKTVSNRKSKKTS
Estimated Isoelectric Point:
5.16791534423828
Estimated Molecular Weight:
37.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys19
Gln11
Leu21
Gly51
Met9
Ser22
Tyr14
His6
Glu29
Arg15
Cys7
Phe6
Pro52
Val12
Asn13
Ala16
Ile12
Trp1
Asp16