Sequence:
download
BM23119sequence.fasta
>Bma-MAB-3 MDEKENNQSTSPGSSRNSSSGGYSSCSTPEEVDVVAFTPRPEPVNEDDQKRYFCQRCLNHAEEHPRKGHKPFCQYANCEC ADCHMVEERRRLNNMLSLRRLDPNHAASRSTTGKKIRDPKCALCSAHGNKQPLRGHKKAQCPFLKCGCHLCGLVENRRTL MARQIKLRRDQQKQRKAQLSAAAAALATTTNIATKSLILEQSNSEVEQGFTDLSEQLITPDHNVKVEEPVRVPPLLPVFP KPQVMEPRPPVPIIFQPTAILPTAPMFISPMDNIDLRLISLNYHHMMNPVPFQFTPMLPYTPTLPFLSAP
view sequence (310 aa)
>Bma-MAB-3
MDEKENNQSTSPGSSRNSSSGGYSSCSTPEEVDVVAFTPRPEPVNEDDQKRYFCQRCLNHAEEHPRKGHKPFCQYANCEC
ADCHMVEERRRLNNMLSLRRLDPNHAASRSTTGKKIRDPKCALCSAHGNKQPLRGHKKAQCPFLKCGCHLCGLVENRRTL
MARQIKLRRDQQKQRKAQLSAAAAALATTTNIATKSLILEQSNSEVEQGFTDLSEQLITPDHNVKVEEPVRVPPLLPVFP
KPQVMEPRPPVPIIFQPTAILPTAPMFISPMDNIDLRLISLNYHHMMNPVPFQFTPMLPYTPTLPFLSAP
Estimated Isoelectric Point:
8.86615753173828
Estimated Molecular Weight:
34.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys17
Gln17
Leu27
Gly10
Met10
Ser22
Tyr5
His11
Glu19
Arg22
Cys13
Phe11
Pro33
Val15
Asn17
Ala21
Ile11
Asp12