Sequence:
download
BM22451sequence.fasta
>Bma-MOG-4, isoform b MADFLEQWVNDELYTLVGCSDRTAVQYILALARKSIDAEDLLGRLRSTDTMEDTPAVRKFISELIARVPHAAAKREKVIQ PSAAELRAKEIMRLNRDLKTIESDDEDDVSTRKREKKKKRKSIIPMKESASDEMDRINAEEEQDLRERDELAARIRQRDK EKTRNIVTKSEKKAEEEAAKRLKLETKDRTKIVSQLREESRKQYLSKRKDDKLDELEKIVEDDEHFFANERLTEREKKDM KYRRDILEYARQHERAADFLKIKRYHVPDAKVKSVPLDSLEDADEIPKGDGKRWEDDRLAAAIAKYGAKDKRFQKRDEFE MVLDDEKIDFIQAFQMPGTADTEEKMFSAAQKKKITLSETRKSLPVYTYRDEFIQAVHDHQVLIIEGETGSGKTTQLPQY LYEAGFCVNKMKVGCTQPRRVAAMSVATRVAEEMGVKLGIEVGYSIRFEDCTSERTVVKYMTDGMLLREFLNEPDLASYS VIIIDEAHERTLHTDVLFGLVKDIARFRKDLKLLVSSATLDVEKFSTFFDDAPILRIPGRRFPVDIYYTKAPEADYLDAA MVSILQIHLTQPLPGDILVFLTGQDEIETLMESLLERTKYFGKKIKELIVLPIYANLPSDLQAKIFEPTPPNARKVVLAT NIAETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKNELEDQPIPE IQRTNLGNVVLMLKSLGIHDLVHFDYLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKY GCSEEIITIAGMLSCNAAVFYRPKALVIHADAARKGFWVPGGDHLTLLNVYNRWRDTNYSSQWCMENFVQYRTMKKARDV RDQLEGLLERVEIDQVSNNDSIAIRKTITAGYFYNCAKLDSNGHYKTVKHKHTVHIHPNSSLFEETPRWMIYFELVFTSK EFMREVIEIESSWLTEVAPHYYRAKELEDSTNRKMPKQKGKAAIELSSL
view sequence (1009 aa)
>Bma-MOG-4, isoform b
MADFLEQWVNDELYTLVGCSDRTAVQYILALARKSIDAEDLLGRLRSTDTMEDTPAVRKFISELIARVPHAAAKREKVIQ
PSAAELRAKEIMRLNRDLKTIESDDEDDVSTRKREKKKKRKSIIPMKESASDEMDRINAEEEQDLRERDELAARIRQRDK
EKTRNIVTKSEKKAEEEAAKRLKLETKDRTKIVSQLREESRKQYLSKRKDDKLDELEKIVEDDEHFFANERLTEREKKDM
KYRRDILEYARQHERAADFLKIKRYHVPDAKVKSVPLDSLEDADEIPKGDGKRWEDDRLAAAIAKYGAKDKRFQKRDEFE
MVLDDEKIDFIQAFQMPGTADTEEKMFSAAQKKKITLSETRKSLPVYTYRDEFIQAVHDHQVLIIEGETGSGKTTQLPQY
LYEAGFCVNKMKVGCTQPRRVAAMSVATRVAEEMGVKLGIEVGYSIRFEDCTSERTVVKYMTDGMLLREFLNEPDLASYS
VIIIDEAHERTLHTDVLFGLVKDIARFRKDLKLLVSSATLDVEKFSTFFDDAPILRIPGRRFPVDIYYTKAPEADYLDAA
MVSILQIHLTQPLPGDILVFLTGQDEIETLMESLLERTKYFGKKIKELIVLPIYANLPSDLQAKIFEPTPPNARKVVLAT
NIAETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKNELEDQPIPE
IQRTNLGNVVLMLKSLGIHDLVHFDYLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKY
GCSEEIITIAGMLSCNAAVFYRPKALVIHADAARKGFWVPGGDHLTLLNVYNRWRDTNYSSQWCMENFVQYRTMKKARDV
RDQLEGLLERVEIDQVSNNDSIAIRKTITAGYFYNCAKLDSNGHYKTVKHKHTVHIHPNSSLFEETPRWMIYFELVFTSK
EFMREVIEIESSWLTEVAPHYYRAKELEDSTNRKMPKQKGKAAIELSSL
Estimated Isoelectric Point:
6.41109466552734
Estimated Molecular Weight:
115.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr56
Lys85
Gln32
Leu90
Gly41
Met26
Ser54
Tyr35
His22
Glu92
Arg74
Cys12
Phe36
Pro38
Val59
Asn27
Ala83
Ile65
Trp8
Asp74