Sequence:
download
BM03459sequence.fasta
>Bma-MOG-4, isoform a MADFLEQWVNDELYTLVGCSDRTAVQYILALARKSIDAEDLLGRLRSTDTMEDTPAVRKFISELIARVPHAAAKREKVIQ PSAAELRAKEIMRLNRDLKTIESDDEDDVSTRKREKKKKRKSIIPMKESASDEMDRINAEEEQDLRERDELAARIRQRDK EKTRNIVTKSEKKAEEEAAKRLKLETKDRTKIVSQLREESRKQYLSKRKDDKLDELEKIVEDDEHFFANERLTEREKKDM KYRRDILEYARQHERAADFLKIKRYHVPDAKVKSVPLDSLEDADEIPKGDGKRWEDDRLAAAIAKYGAKDKKRDEFEMVL DDEKIDFIQAFQMPGTADTEEKMFSAAQKKKITLSETRKSLPVYTYRDEFIQAVHDHQVLIIEGETGSGKTTQLPQYLYE AGFCVNKMKVGCTQPRRVAAMSVATRVAEEMGVKLGIEVGYSIRFEDCTSERTVVKYMTDGMLLREFLNEPDLASYSVII IDEAHERTLHTDVLFGLVKDIARFRKDLKLLVSSATLDVEKFSTFFDDAPILRIPGRRFPVDIYYTKAPEADYLDAAMVS ILQIHLTQPLPGDILVFLTGQDEIETLMESLLERTKYFGKKIKELIVLPIYANLPSDLQAKIFEPTPPNARKVVLATNIA ETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKNELEDQPIPEIQR TNLGNVVLMLKSLGIHDLVHFDYLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYGCS EEIITIAGMLSCNAAVFYRPKALVIHADAARKGFWVPGGDHLTLLNVYNRWRDTNYSSQWCMENFVQYRTMKKARDVRDQ LEGLLERVEIDQVSNNDSIAIRKTITAGYFYNCAKLDSNGHYKTVKHKHTVHIHPNSSLFEETPRWMIYFELVFTSKEFM REVIEIESSWLTEVAPHYYRAKELEDSTNRKMPKQKGKAAIELSSL
view sequence (1006 aa)
>Bma-MOG-4, isoform a
MADFLEQWVNDELYTLVGCSDRTAVQYILALARKSIDAEDLLGRLRSTDTMEDTPAVRKFISELIARVPHAAAKREKVIQ
PSAAELRAKEIMRLNRDLKTIESDDEDDVSTRKREKKKKRKSIIPMKESASDEMDRINAEEEQDLRERDELAARIRQRDK
EKTRNIVTKSEKKAEEEAAKRLKLETKDRTKIVSQLREESRKQYLSKRKDDKLDELEKIVEDDEHFFANERLTEREKKDM
KYRRDILEYARQHERAADFLKIKRYHVPDAKVKSVPLDSLEDADEIPKGDGKRWEDDRLAAAIAKYGAKDKKRDEFEMVL
DDEKIDFIQAFQMPGTADTEEKMFSAAQKKKITLSETRKSLPVYTYRDEFIQAVHDHQVLIIEGETGSGKTTQLPQYLYE
AGFCVNKMKVGCTQPRRVAAMSVATRVAEEMGVKLGIEVGYSIRFEDCTSERTVVKYMTDGMLLREFLNEPDLASYSVII
IDEAHERTLHTDVLFGLVKDIARFRKDLKLLVSSATLDVEKFSTFFDDAPILRIPGRRFPVDIYYTKAPEADYLDAAMVS
ILQIHLTQPLPGDILVFLTGQDEIETLMESLLERTKYFGKKIKELIVLPIYANLPSDLQAKIFEPTPPNARKVVLATNIA
ETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKNELEDQPIPEIQR
TNLGNVVLMLKSLGIHDLVHFDYLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYGCS
EEIITIAGMLSCNAAVFYRPKALVIHADAARKGFWVPGGDHLTLLNVYNRWRDTNYSSQWCMENFVQYRTMKKARDVRDQ
LEGLLERVEIDQVSNNDSIAIRKTITAGYFYNCAKLDSNGHYKTVKHKHTVHIHPNSSLFEETPRWMIYFELVFTSKEFM
REVIEIESSWLTEVAPHYYRAKELEDSTNRKMPKQKGKAAIELSSL
Estimated Isoelectric Point:
6.34017181396484
Estimated Molecular Weight:
115.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr56
Lys85
Gln31
Leu90
Gly41
Met26
Ser54
Tyr35
His22
Glu92
Arg73
Cys12
Phe35
Pro38
Val59
Asn27
Ala83
Ile65
Trp8
Asp74