Sequence:
download
BM02432sequence.fasta
>Bma-MEI-1 MEWEISESYRAAKEAAVRRKYDQSALFLRTALSLVERRLNDISTDDPHRDQLIKVKSILKLNVERMSGIADVVSQMRQMA GVITSSSPVDAPPSDPDVWPLPPLTKKISAIPSPKNSAKKQAYTRVDNKTKKGLVGKSPFINSGGRNITKRANSLGRASV NELSEITSKEEGESNSNEKGGSEKVFDDRGFDKELVEIIERDIMQKRPDVHWDDIAGLDEAKKLLKEAVILPSVMPNFFK GIRRPWRGVCMVGPPGTGKTMLAKAVATESQTTFFCVSSATLTSKYRGDSEKLVQLLFKMARFYAPSTIFIDEIDSLCSR RGADSEHEASRRVKSELLTQMDGCSPDVSRVLVLAATNFPWDLDEALRRRLEKRIYIPLPDKTNRFQLLKLALAEVSIDE EVNLEIVADSLDGYSGADITNVCREAAMMSMRVRIANLTAEEIKALTQEEVDLPITANDFSQAIQNTSPSVSYSDVQKYE KWIHDFGAA
view sequence (489 aa)
>Bma-MEI-1
MEWEISESYRAAKEAAVRRKYDQSALFLRTALSLVERRLNDISTDDPHRDQLIKVKSILKLNVERMSGIADVVSQMRQMA
GVITSSSPVDAPPSDPDVWPLPPLTKKISAIPSPKNSAKKQAYTRVDNKTKKGLVGKSPFINSGGRNITKRANSLGRASV
NELSEITSKEEGESNSNEKGGSEKVFDDRGFDKELVEIIERDIMQKRPDVHWDDIAGLDEAKKLLKEAVILPSVMPNFFK
GIRRPWRGVCMVGPPGTGKTMLAKAVATESQTTFFCVSSATLTSKYRGDSEKLVQLLFKMARFYAPSTIFIDEIDSLCSR
RGADSEHEASRRVKSELLTQMDGCSPDVSRVLVLAATNFPWDLDEALRRRLEKRIYIPLPDKTNRFQLLKLALAEVSIDE
EVNLEIVADSLDGYSGADITNVCREAAMMSMRVRIANLTAEEIKALTQEEVDLPITANDFSQAIQNTSPSVSYSDVQKYE
KWIHDFGAA
Estimated Isoelectric Point:
6.53253936767578
Estimated Molecular Weight:
54.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys36
Gln14
Leu41
Gly23
Met13
Ser47
Tyr9
His4
Glu36
Arg34
Cys5
Phe15
Pro24
Val34
Asn18
Ala41
Ile30
Trp6
Asp35