Sequence:
download
BM00248sequence.fasta
>Bma-LIN-7 MEESSDGLHLDRDIQRILELIEHVQKTGELNSPKLTSLQNILQSDFFSSVREVFENVYDTISADSAREVRTSATAKATVA AFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRNGQLKRGDQLVAVNGVNVEWESHEKAVDLL KSARGTVRLVVRYTPRLLDEMERRFERQRRRANQTSPAPIFKR
view sequence (203 aa)
>Bma-LIN-7
MEESSDGLHLDRDIQRILELIEHVQKTGELNSPKLTSLQNILQSDFFSSVREVFENVYDTISADSAREVRTSATAKATVA
AFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRNGQLKRGDQLVAVNGVNVEWESHEKAVDLL
KSARGTVRLVVRYTPRLLDEMERRFERQRRRANQTSPAPIFKR
Estimated Isoelectric Point:
8.03986358642578
Estimated Molecular Weight:
22.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys9
Gln10
Leu17
Gly13
Met3
Ser15
Tyr3
His5
Glu17
Arg20
Phe7
Pro8
Val17
Asn9
Ala17
Ile11
Trp1
Asp11